KEGG   Mus musculus (mouse): 67873Help
Entry
67873             CDS       T01002                                 

Gene name
Mri1, 2410018C20Rik
Definition
(RefSeq) methylthioribose-1-phosphate isomerase 1
  KO
K08963  methylthioribose-1-phosphate isomerase [EC:5.3.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    67873 (Mri1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.23  S-methyl-5-thioribose-1-phosphate isomerase
     67873 (Mri1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B
Motif
Other DBs
NCBI-GeneID: 67873
NCBI-ProteinID: NP_080699
MGI: 1915123
Ensembl: ENSMUSG00000004996
Vega: OTTMUSG00000032850
UniProt: Q9CQT1
Position
8; 8 C2
AA seq 369 aa AA seqDB search
MTLEAIRYSPGSLQILDQLQLPEHCHYEALSSVQQASEAIRAMKVRGAPAIALVGCLSLA
VELRAGAGGPGLAALVAFVRDQLRLLVAARPTAVNMARAARDLGQVAAQEAEREGATEET
VRERVIRFAEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGT
ALGVIRSLHEMGRLEHTFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMAHRGV
SAVVVGADRVVANGDTANKIGTYQLAIVAKHHGVPFYVAAPSSSCDLHLETGKEIVIEER
PSQELTDLNGVRIAAQGIRVWNPAFDVTPHELITGGIITELGVFAPEELRGALSASVFSE
GQTLDSPWV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacactggaagcgatccgctactcgcccggctcgctgcagatcctcgaccagctgcag
ctgccagagcactgccactatgaggcactgagctccgtgcagcaggctagtgaagccatc
cgcgccatgaaggtgcgcggagccccggccatcgcgctggtcggctgcctcagcctggcc
gtggagctgcgggccggcgccggcggtcccggactcgctgctctggtggccttcgtgcga
gaccagctgcgcctcttagtcgccgcccggcccaccgctgtcaacatggcccgcgccgcc
cgcgatctgggtcaagtggcagcccaggaggcggaacgagagggtgccactgaagagacc
gtgcgggaaagagtgatccgcttcgccgaggatatgttggagaaggacctcaaagacaac
cggagcatcggggacttgggagcccgccatctcctagagcagaccaaccccaggggtggc
aaggtgaccgtgctgacccactgtaacacgggtgctctggccactgctggctatggtaca
gcgttaggtgtgatccgctcactgcatgagatgggccgattggagcataccttctgcaca
gagacccggccctacaaccagggagcccggctgacggccttcgagctggtgtacgagcag
atccctgcaactctcatcactgacagcatggcggcggctgccatggcacaccggggtgtg
tcagccgtggtggtgggagctgaccgtgttgttgccaatggagacacagccaacaaaata
ggcacctatcagctggccattgtcgccaaacaccacggtgtccccttctatgtggctgcc
cccagttcatcctgtgacctccatctggagactggaaaggagattgtcatagaggaacgc
cccagccaggagctaactgacctgaatggagtcaggattgctgcacagggaatccgggtt
tggaatcctgcctttgatgtcaccccccacgaactcatcacaggtggcatcatcactgaa
ctgggtgtctttgcccctgaggagctccgaggagccctaagtgcctccgtcttctcagag
ggacagaccctagatagtccctgggtgtga

DBGET integrated database retrieval system