KEGG   Mus musculus (mouse): 67876
Entry
67876             CDS       T01002                                 

Symbol
Coq10b, 1500041J02Rik, 1700030I21Rik, 9530077A17Rik, AV002237, AW742641
Name
(RefSeq) coenzyme Q10B
  KO
K18588  coenzyme Q-binding protein COQ10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    67876 (Coq10b)
SSDB
Motif
Pfam: Polyketide_cyc
Other DBs
NCBI-GeneID: 67876
NCBI-ProteinID: NP_001034799
MGI: 1915126
Ensembl: ENSMUSG00000025981
Vega: OTTMUSG00000046967
UniProt: Q3THF9 A0A0R4J066
Position
1:55091929..55111861
AA seq 242 aa
MIMAARTSQRALARVASGCHPKSTTVTEAPARGSARDVRHLAACGVLINRTLPPCAAVLP
KEICARTFFRISAPLVNKRKEYSERRILGYSMQEMYDVVSGMEDYQHFVPWCKKSDIISR
RSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETIWRFSPGLPGYPR
TCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRELMLHEIH
HT
NT seq 729 nt   +upstreamnt  +downstreamnt
atgatcatggcagctcggaccagtcagagggccctggcgagggtggcatcggggtgccat
ccgaagtcgaccaccgtgacggaagccccggcgcgggggtctgcgcgcgacgtcagacac
ttagctgcctgtggtgtactgataaacagaacccttccaccgtgtgctgcagttttgcct
aaagagatctgtgcgagaactttcttcagaatctctgcgccactagtaaataaacgaaag
gagtattcagagagaagaattctagggtactcaatgcaagaaatgtatgacgtagtatca
ggaatggaggactatcagcatttcgttccctggtgtaaaaagtcagatataatatcaagg
cgatctggatactgtaaaaccagattagaagttgggttcccccccgttctggagagatac
acatcaatagtaaccttggtaaaaccgcacttggtaaaggcatcttgtactgatgggaaa
cttttcaatcatttggagactatttggcgttttagcccaggtcttcctggctatccaaga
acttgtaccttggatttttcaatttcttttgaattccgctcccttctgcactctcagctc
gctactctgttcttcgatgaagttgtgaaacaaatggtagcagcctttgaaagaagagcc
tgtaaactgtatggtccagagacaaacatacctcgggaattaatgcttcatgaaattcac
cacacctaa

DBGET integrated database retrieval system