KEGG   Mus musculus (house mouse): 67880
Entry
67880             CDS       T01002                                 
Symbol
Dcxr, 0610038K04Rik, 1810027P18Rik, XR
Name
(RefSeq) dicarbonyl L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu01100  Metabolic pathways
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    67880 (Dcxr)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     67880 (Dcxr)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 ADH_zinc_N Shikimate_DH RmlD_sub_bind Sacchrp_dh_NADP THF_DHG_CYH_C NAD_binding_7 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 67880
NCBI-ProteinID: NP_080704
MGI: 1915130
Ensembl: ENSMUSG00000039450
UniProt: Q91X52
Position
11:complement(120615372..120618110)
AA seq 244 aa
MDLGLAGRRALVTGAGKGIGRSTVLALKAAGAQVVAVSRTREDLDDLVRECPGVEPVCVD
LADWEATEQALSNVGPVDLLVNNAAVALLQPFLEVTKEACDTSFNVNLRAVIQVSQIVAK
GMIARGVPGAIVNVSSQASQRALTNHTVYCSTKGALDMLTKMMALELGPHKIRVNAVNPT
VVMTPMGRTNWSDPHKAKAMLDRIPLGKFAEVENVVDTILFLLSNRSGMTTGSTLPVDGG
FLAT
NT seq 735 nt   +upstreamnt  +downstreamnt
atggacctggggcttgcaggtcggcgggcgctggtcaccggcgcgggcaaaggcatcggg
cgcagcactgtgctggcgttgaaggcggctggtgcacaggttgtggcggtgagtcggacg
cgagaggacctggacgacctggtccgcgagtgtcctggtgtggagcctgtgtgtgtggac
ctggccgactgggaggccacagagcaggccctaagcaatgtgggacccgtggaccttctg
gtgaacaatgctgctgtggctctgttgcagcccttcctggaggtcaccaaggaggcctgt
gacacatccttcaatgtgaatcttcgggctgtcatccaggtgtctcagattgtggccaag
ggcatgatagctcggggagttccaggagccattgtgaatgtctccagccaggcctcccaa
cgtgcactgaccaaccatactgtctactgttccaccaagggtgctctggacatgttgacc
aagatgatggccctagagcttgggccccacaagatccgtgtgaatgcagtaaaccccaca
gtagtgatgacacccatgggccggaccaactggagtgacccccacaaagctaaggccatg
ctggatcgtatcccactgggcaagttcgctgaggtggagaacgtcgtggacaccattctc
ttcctgctgagcaaccggagtggcatgaccactggctccactttgccagtggatgggggc
ttcctggctacctga

DBGET integrated database retrieval system