KEGG   Mus musculus (mouse): 67888
Entry
67888             CDS       T01002                                 

Symbol
Tmem100, 1810057C19Rik, AV011897
Name
(RefSeq) transmembrane protein 100
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TMEM100 PIRT Claudin_2 SpoIIM Neurensin Saf_2TM Ytp1 Peptidase_U4 DUF4131
Other DBs
NCBI-GeneID: 67888
NCBI-ProteinID: NP_080709
MGI: 1915138
Ensembl: ENSMUSG00000069763
Vega: OTTMUSG00000001282
UniProt: Q9CQG9
Position
11; 11 C
AA seq 134 aa
MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPF
AVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRE
SQTALVVNQRCLFA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaccgaagaatccacaaaagagaacctgggagctccaaaatctcccacacctgtgaca
atggagaaaaaccccaagagggaagttgtggtcaccacgggacccttggtcagcgaggtt
cagctgatggccgccaccgggggtgccgaactctcctgctaccgctgcatcatccccttt
gccgtggtggtcttcatcactgggattgtggtcaccgctgtggcttacagcttcaattcc
catggttccatcatctccatcttcggcctggtccttctgtcctccggactgtttttacta
gcctccagtgccttgtgctggaaggtgagacaaaggaacaagaaagtcaagagacgcgag
agtcagaccgctcttgtggtaaatcagaggtgcttgtttgcttaa

DBGET integrated database retrieval system