KEGG   Mus musculus (mouse): 67892Help
Entry
67892             CDS       T01002                                 

Gene name
Coa6, 1810063B05Rik, AI447995
Definition
(RefSeq) cytochrome c oxidase assembly factor 6
  KO
K18179  cytochrome c oxidase assembly factor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    67892 (Coa6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    67892 (Coa6)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    67892 (Coa6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6B CHCH DUF5331 Pet191_N
Motif
Other DBs
NCBI-GeneID: 67892
NCBI-ProteinID: NP_778152
MGI: 1915142
Ensembl: ENSMUSG00000051671
Vega: OTTMUSG00000061600
UniProt: Q8BGD8
Position
8; 8 E2
AA seq 79 aa AA seqDB search
MAAPSMKERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLK
FKEKFEAGGFQSSQSTENS
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccttccatgaaggaaaggcaggcatgctggggtgcgcgcgacctgtactgg
cgctgcctggacgacaacgcggaggacgcggcccggtgccagaagctgaggagctcgttc
gaggccagctgcccccagcagtggataaaatattttgacaaaagaagagactacttaaaa
ttcaaggaaaaatttgaagcaggaggattccagtcttcacagtcgactgaaaattcctag

DBGET integrated database retrieval system