KEGG   Mus musculus (mouse): 67894Help
Entry
67894             CDS       T01002                                 

Gene name
Fam45a, 1810055E12Rik
Definition
(RefSeq) family with sequence similarity 45, member A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Avl9 SPA DUF2347
Motif
Other DBs
NCBI-GeneID: 67894
NCBI-ProteinID: NP_080713
MGI: 1915144
Ensembl: ENSMUSG00000024993
Vega: OTTMUSG00000028236
UniProt: Q9D8N2
Position
19; 19 D3
AA seq 357 aa AA seqDB search
MAAVVAMDTQLMLGVGLIEKDSNGEALWVWCYPSTTASLRNLLLRKCCLTDENKLLHPFV
FGQYRRTWFYVTTVEVPDSSVLKKVTHFSIVLTAKDFNPEKYAAFTRILCRIYLKYGSPV
KMMESYIAVLTKGICQSEENGSFLSRDFDGRKAYLAGSIKDIVSQFGMETVILHTALMLK
KRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYMHLHAEELEGLQMCTGYIAGFVEL
EVSNRPDLYDVFVNLADSEITIAPLAKEAMTMGKLHKEIGQLIVQSAEDPEKSDSQVIQD
IALKTKEIFTHLAPFSEVSDDGGKVILNVEALKQQRFPPATENFLYHLAAAEQMLKV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggttgtggcaatggacacccagctgatgctcggagtcgggctgatcgaaaag
gactctaatggagaagccctgtgggtgtggtgttatccttccacgacagcctcactaagg
aatctgctgctccgaaaatgctgcctaactgatgaaaacaaacttctccaccctttcgtc
tttggtcagtacagaagaacatggttttatgtcacgacagttgaagttccagattcttca
gttttgaaaaaggtgactcatttttctattgttctgaccgccaaagattttaacccagag
aaatatgccgccttcactaggatattgtgtagaatatatttgaaatatggaagtccggtt
aaaatgatggagagttacattgcagttctcaccaaggggatctgccagagtgaagaaaat
ggctctttccttagtagagactttgatggtcgaaaggcataccttgctggctccatcaaa
gacattgtatctcaatttggaatggaaactgttattttacacacagcattgatgctgaaa
aaacgaattgttgtctatcaccccaaaatagaagctgtccaggagttcaccaggactctg
cctgccctggtgtggcatcgacaggattggaccatcctgcattcttacatgcaccttcat
gctgaagagctagaaggcctacagatgtgcacaggctacattgctggctttgtagaattg
gaggtgagcaacagaccagacctctatgacgtgtttgtgaatctggcagatagtgagatc
accatcgctccacttgcaaaagaggccatgacgatgggcaaactgcataaagagattggt
caactaattgtgcaatctgcagaagacccagagaaatcagacagccaggttatacaggac
attgccctaaaaacaaaagaaatcttcactcacctggcaccattctcagaagtgtctgat
gatgggggaaaagtcatcctcaatgttgaggcactgaagcagcagcgatttccacccgca
acagaaaacttcctgtatcatctagcagcagctgaacaaatgctgaaggtctga

DBGET integrated database retrieval system