KEGG   Mus musculus (mouse): 67903Help
Entry
67903             CDS       T01002                                 

Gene name
Gipc1, GIPC, Glut1CIP, Rgs19ip1, Semcap1, TIP-2, TaxIP2
Definition
(RefSeq) GIPC PDZ domain containing family, member 1
  KO
K20056  PDZ domain-containing protein GIPC
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67903 (Gipc1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    67903 (Gipc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PyrI
Motif
Other DBs
NCBI-GeneID: 67903
NCBI-ProteinID: NP_061241
MGI: 1926252
Ensembl: ENSMUSG00000019433
Vega: OTTMUSG00000061609
UniProt: Q9Z0G0
Structure
PDB: 

Position
8; 8 C2
AA seq 333 aa AA seqDB search
MPLGLGRRKKAPPLVENEEAEPSRSGLGVGEPGPLGGSAAGESQMGLPPPPAALRPRLVF
HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLE
DFIFAHVKGQRKEVEVFKSEEALGLTITDNGAGYAFIKRIKEGSVIDHIQLISVGDMIEA
INGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGHPGSGPQLGTGR
GTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDEL
AEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgccactgggactggggcgaaggaagaaagcaccgcctctggtggaaaatgaggaggcg
gagccaagccggagtgggctgggtgttggggagcctgggcccctgggtgggagcgcagca
ggagaatcccagatgggcttgcccccacctcctgctgccctccggcctcgcctcgtgttc
catacccagctggcccacggcagccccacaggccgcatcgagggcttcactaatgtcaag
gagctgtacggcaagatcgctgaggccttccgactaccagctgctgaggtgatgttctgc
accctcaacacccacaaagtggacatggacaaactcctggggggccagatcggcctggaa
gacttcatctttgcccatgtgaaggggcagcgcaaagaggtggaagtgttcaagtcggag
gaggctctggggctcaccatcaccgacaacggggccggctacgccttcattaagcgcatc
aaggaaggcagtgtgattgaccacattcagctcatcagcgtgggggacatgattgaagcc
atcaacgggcagagcctgctgggctgtcggcattacgaggttgccaggctcctcaaggag
ctgccccgaggccgcaccttcaccctcaaactcacagaacctcgaaaggcctttgatatg
atcagccagcgttcagccggtggccaccctggttcaggcccacaactgggcactggccga
gggaccctccgtctccgatcccggggccctgccaccgtggaggatctgccgtcggccttt
gaggagaaggccattgagaaggtggatgacttgctagagagctacatggggatcagagac
acggagctggctgccaccatggtggagctgggaaaggacaaaaggaacccggacgagctg
gcagaagccctggatgagcggctcggtgacttcgcattcccagatgaatttgtctttgat
gtctggggagctatcggggatgccaaggttggccgctactaa

DBGET integrated database retrieval system