KEGG   Mus musculus (mouse): 67911Help
Entry
67911             CDS       T01002                                 

Gene name
Zfp169, 1700025J14Rik, 4930429A13Rik, BE688704
Definition
(RefSeq) zinc finger protein 169
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    67911 (Zfp169)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    67911 (Zfp169)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    67911 (Zfp169)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 KRAB zf-Di19 ADK_lid zf-C2H2_6 Zn_ribbon_SprT zf-C2H2_11 zinc_ribbon_15 DUF3268 IBR
Motif
Other DBs
NCBI-GeneID: 67911
NCBI-ProteinID: NP_001158047
MGI: 1915161
Ensembl: ENSMUSG00000050954
Vega: OTTMUSG00000038565
UniProt: E9Q3R6 Q6PAM4
Position
13; 13 A5
AA seq 731 aa AA seqDB search
MAPGLLTTRDKALMAFHDVAVAFSQMEWELLSPAQRILYRDVMLENYSHLVSLGIAFSKP
KLITQLEQGAEPWRDGSGCFLDLCPEPRTELEPSLSSPVSFASPEVLRVCVLNGPPSQTF
PSPPAGSNFQSEAPGCSSNEGGEERDSSDALLQRTSPTRILKTFFSPCQDQAAYWVEGDS
KQTDLGLAPEEAVTVLKGPDESASGAVLHGAFPLGLDDVTNLFSPQKHHVFPDCGGGFCQ
SSDLMKLQRMDGVEKPYSCSECGHQFAQKASLTVHQRKHSGEKPHVCEECGRGFMYVSSL
NSHKKIIHSGESPLVCPECGRGFRQKIDLLLHQRTHLDKKPFVCPECGRGFCRKASLLQH
SWSHSGDNPFICSVCGRGFRLLSRLLTHQVTHSGEKPHVCPDCGQRFGQKGTLMRHQKTH
TGEKPFVCRQCGWSFTQKVNLIRHQRIHTEVKPFLCPECGRAFEFKSLLTRHRKTHMGEK
PYVCPQCGRGFSQKFNLIGHQRIHTGELPFLCPECGRAFVKQSMLIRHQRTHAGWEKPYQ
CPECGRTFEFKSLLTRHQKIHTGEKPYVCPQCGRGFSQKFNLIGHQKTHTGEKPYACPQC
GQRFRQKFNLARHQRIHTGEKPFLCAECGRAFGKKVSLIRHQRTHGEEKPYQCTECGRAF
EFKSLFIRHQKTHTGEKPYVCPECGKAFSQKFNLIGHQRSHTGEKPYLCPQCGRAFAFKS
LLTRHQRTHSK
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggccccagggctcctgacaaccagagacaaggcattaatggccttccatgacgtggct
gtggccttcagccagatggagtgggagctgctgagtcctgcccagaggatcctgtacagg
gatgtaatgctggagaactatagccaccttgtctccctgggaattgccttttccaaacca
aaactcatcacgcagctggaacaaggggcagaaccctggagagatggcagcggatgcttt
ctggacctttgtccagaacccaggacagaattagagccctctctttcgtccccggtatcc
tttgctagtccggaagtcctcagagtgtgtgtgctgaatggacctccctctcagactttt
ccaagcccaccagcagggagcaacttccagtcagaagctccaggctgttccagcaatgaa
ggaggtgaagagagagacagcagcgatgctctgttgcagaggacaagtccaacgagaatt
ctgaagacgttctttagcccatgtcaagatcaggcagcatactgggtagaaggcgacagt
aaacaaacagaccttggcctggcccctgaggaggcagtcacagtgttgaagggacccgat
gagtcagcatctggggccgtcctacatggagcatttccgctagggcttgatgatgtcaca
aacctgttcagccctcagaagcaccacgtgtttcctgactgcggagggggcttttgccag
agttctgacctcatgaagctccagagaatggacggagtggagaagccttactcgtgttcg
gagtgcgggcaccagttcgctcagaaggcgtctctcacggtccatcagaggaaacactct
ggagagaagccgcacgtgtgtgaggagtgtgggcgaggcttcatgtatgtatcctccctc
aacagccacaagaagattatccactctggagagagcccccttgtttgtcccgagtgtggg
cgtggcttccgccagaagatagacctcctcctccaccagcggactcacctggataaaaag
cccttcgtgtgtcccgagtgtgggaggggcttttgccggaaagcctcgctgctacagcac
agctggtcacactcgggtgacaaccccttcatctgctcggtgtgtgggcgtggcttcagg
ctgctctcccggctcctcactcaccaggtcacacactctggtgagaaacctcacgtttgc
ccggactgcggacaacgctttggccaaaagggtacgctcatgagacatcagaagacacat
accggggagaagccttttgtgtgtcgccagtgtggctggagtttcacccagaaggttaac
ctcattaggcaccagaggattcacacagaggtaaaacctttcctatgccctgagtgtgga
cgagcctttgagtttaagtcgctcctcaccagacaccgtaaaacgcacatgggggagaag
ccctacgtgtgcccccagtgtggtagggggtttagccagaagttcaacctcatcgggcac
cagaggattcatacaggggagttaccttttctgtgccctgagtgtgggcgtgcgtttgta
aagcagtccatgctcatcagacaccagaggacccacgcagggtgggagaaaccttaccag
tgtcccgagtgtggacgcacctttgagtttaagtcgctcctcaccagacaccagaagata
cacacgggggagaagccttatgtgtgtcctcagtgtggcagagggtttagccagaagttc
aacctcattgggcaccagaagacacacacgggggaaaagccctatgcctgtccccagtgt
ggccagcgcttcaggcagaagttcaacctcgctaggcaccagaggattcacacgggggag
aagccattcctgtgtgctgagtgtgggcgagcatttggaaagaaggtctctctcattaga
caccagaggacccacggagaggagaagccttaccagtgtactgagtgtggtcgagccttt
gagtttaagtctcttttcatcagacaccaaaagacacatacgggggagaagccctacgtg
tgccctgagtgtggcaaggcatttagccaaaagttcaaccttatagggcaccagaggagc
catacaggggagaagccttacctgtgcccccagtgtgggcgtgcctttgcttttaagtca
cttcttactagacaccagaggacacactccaagtag

DBGET integrated database retrieval system