KEGG   Mus musculus (house mouse): 67917
Entry
67917             CDS       T01002                                 
Symbol
Zcchc3, 2810406K24Rik
Name
(RefSeq) zinc finger, CCHC domain containing 3
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-CCHC zf-CCHC_2 zf-CCHC_4
Other DBs
NCBI-GeneID: 67917
NCBI-ProteinID: NP_780335
MGI: 1915167
Ensembl: ENSMUSG00000074682
UniProt: Q8BPK2
Position
2:complement(152253876..152256964)
AA seq 400 aa
MATGGGAEEESQRGRPQLPLPARPVARVEEPEGVREKMGWAQVVKNLAEKKGDFREPRRR
DETGSGASGGLGSPGGLATPNPGDFPPAARGDPKGRRRDPTGEASDAYRKKSASGAGDPS
RRKKAEVTAAMATPARPGTTEDATERPLQDEPPAAGPGKGRFLVRICFQGDESACPTRDF
VVGALILRSIGMDPDDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKRELEDCWENFV
VLGRSRSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIEL
RQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGTCTQDRCFRCGEEGHLS
PYCRKVIVCNLCGKRGHAFAQCPKAVHNSVTAQLTSVAGH
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggccaccggcggcggagcggaggaggagtcacagcggggccggcctcagctcccgctc
cccgcgcgacccgtggcccgcgtcgaggaacccgagggcgtccgcgagaagatgggctgg
gcccaggtggtcaagaacctggcggagaagaagggcgacttccgcgagccgcggcggcgc
gacgaaactggcagcggtgcaagtggcgggctcggcagccccgggggcctggccaccccg
aaccccggcgacttcccacccgccgctcgcggggacccaaagggccgccgcagagaccct
acgggtgaggcgtcagacgcttacaggaaaaagagcgcgagcggcgcgggagacccgagt
cgaaggaagaaggccgaggtgacggcggccatggcgacccccgccaggcccggcacgacc
gaagatgccaccgagcgaccgctccaggacgagccaccggctgccggcccgggtaagggc
cgcttcctcgtgcgcatctgtttccagggagacgaaagtgcctgtccgacccgggacttc
gtggtgggcgcgctcatcctgcgctccatcggcatggaccctgacgacatctacgcggtc
attcagatccccggcagccgcgagttcgacgtgagtttccgatccgccgaaaagctagcc
ctgtttctccgcgtctacgaggagaagcgagagctggaggactgctgggagaactttgtg
gttttggggcggagcaggtccagcctgaagaccctcttcatcctcttccggaacgagacc
gtggacgtggaggacatcgtgacctggctcaagcgccactgcgacgtgctggccgtgccc
gtgaaagtgaccgacaggttcgggatctggaccggggagtacaagtgcgagatcgagctg
cgccagggggagggcggagtgaggcacctgcccggggccttcttcttgggagcggagagg
ggctacagctggtacaaggggcagcccaagacgtgctttaagtgtggttcccggacccac
atgagcggcacctgcacgcaggacaggtgtttcaggtgcggggaagaggggcacctgagc
ccttactgccggaaggtcatcgtgtgcaacctctgtggcaaaagaggacacgcctttgcc
cagtgtcccaaagcagttcacaattccgtgacagctcagctcaccagcgtggcggggcac
tga

DBGET integrated database retrieval system