KEGG   Mus musculus (mouse): 67921Help
Entry
67921             CDS       T01002                                 

Gene name
Ube2f, 2510010F15Rik, AI851109
Definition
(RefSeq) ubiquitin-conjugating enzyme E2F (putative)
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    67921 (Ube2f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67921 (Ube2f)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     67921 (Ube2f)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   67921 (Ube2f)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con
Motif
Other DBs
NCBI-GeneID: 67921
NCBI-ProteinID: NP_080730
MGI: 1915171
Ensembl: ENSMUSG00000034343
Vega: OTTMUSG00000048490
UniProt: Q9CY34
Position
1; 1 D
AA seq 185 aa AA seqDB search
MLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYI
KRYAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgctggcaagcaagttgaagcgggatgatggtctcaaaggatcccggacatca
gcctccacatctgactctacccggagggtttctgtgagagacaagttgcttgttaaagag
gttgcagaacttgaagctaatttaccttgtacatgtaaagtacattttcctgatccaaac
aagcttcattgctttcagctgactgtaagcccagatgagggttactaccagggtggaaaa
tttcagtttgaaactgaagttcccgatgcctacaacatggtgcctcccaaggtgaaatgc
ttgactaaaatctggcaccccaacatcacagaaacgggggaaatatgtctaagtttacta
agagaacattcaattgatggcactggctgggctcccactagaacattaaaggatgttgtt
tggggattaaactctttatttaccgatctcttgaattttgatgatccactgaatattgaa
gctgcagaacatcatttgcgggacaaggaggattttcgggacaaagtggatgaatacatc
aaacgctatgccagatga

DBGET integrated database retrieval system