KEGG   Mus musculus (mouse): 67937
Entry
67937             CDS       T01002                                 

Symbol
Tmem59l, 5330410G16Rik
Name
(RefSeq) transmembrane protein 59-like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BSMAP
Other DBs
NCBI-GeneID: 67937
NCBI-ProteinID: NP_892036
MGI: 1915187
Ensembl: ENSMUSG00000035964
Vega: OTTMUSG00000061442
UniProt: Q7TNI2
Position
8; 8 B3.3
AA seq 337 aa
MAAVALPLLLLLASLVTPTPARDPFAPQLGDTQRCQQRCRQHHPGSPPAQPEPEGPSESP
NNKAILISACERGCRLFSICRFVAKSSRPNATETECEAACTEAYVKAAEQRACSEGCWGQ
IPEPETQLEQKDLALDPPRGRLSLRYLFSMLCSDLMSSAQGFLSSSWTYSLQTDNRKVVV
FQTQPVAENFAFQGSHLQRVEVTWRRSHPKALELHMDPVGPLDKVRKAKPRVKTSKAKVE
SEDQQESDFLSCMSRRSGLPRWVLFCCLFLSILIMLWLSCCTLVTTPGQHLKFQPLTAEQ
HKGLLVESDWPLYPPLPPPAYEDSTPPYKLKLDLTTL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggctgcggtagcattgccgctgctgctgttgttggcgtcactggtcaccccaacccca
gcgcgtgaccccttcgctccgcagctcggggacactcagaggtgccagcagcggtgtcgc
cagcaccaccctggctcgcctcctgcgcagcctgagccagagggtccctcagagtccccg
aataacaaggctatcctgatcagtgcttgtgagcgtggctgtcggcttttctccatctgc
cgctttgtggccaagagctctaggcccaatgccacagagacagaatgtgaagcagcctgc
acagaagcttacgtgaaggcagcggagcaacgggcctgcagtgaggggtgctggggccag
atccctgaacctgagacccagctggagcagaaggacttggctttggacccgcccaggggg
cgcctctcccttcggtacctgttttccatgctctgtagcgacctgatgagttctgcccag
ggctttctatcctcctcctggacatattcccttcagacagacaaccggaaagtggtggtg
ttccagactcagcctgtagcagagaactttgcattccaagggagccatctgcagcgagtg
gaggtgacctggaggaggtcccaccccaaggccctagaactgcacatggaccctgtaggc
cccttggacaaagtgaggaaggctaagccccgagtgaagaccagcaaagccaaggtagag
tctgaggaccaacaagagagtgacttcctcagttgcatgtcccggcgctccgggctgcct
cgatgggtcctattctgctgtctcttcctgtccatcctgatcatgctctggctgagttgc
tgcactctggtcaccacaccaggccagcacctcaagttccagcctctaactgcagaacag
cacaagggcctcttggtggagtctgactggcccttatacccacccctgccgccgcctgcc
tatgaggacagcacacctccttacaagttgaagcttgatttgaccacgctgtaa

DBGET integrated database retrieval system