KEGG   Mus musculus (mouse): 67938Help
Entry
67938             CDS       T01002                                 

Gene name
Myl12b, 1500001M02Rik, C77744, Mylc2b, RLC-B
Definition
(RefSeq) myosin, light chain 12B, regulatory
  KO
K12757  myosin regulatory light chain 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    67938 (Myl12b)
   04530 Tight junction
    67938 (Myl12b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    67938 (Myl12b)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    67938 (Myl12b)
   04670 Leukocyte transendothelial migration
    67938 (Myl12b)
  09158 Development and regeneration
   04360 Axon guidance
    67938 (Myl12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67938 (Myl12b)
   04147 Exosome [BR:mmu04147]
    67938 (Myl12b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     67938 (Myl12b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   67938 (Myl12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 UPF0154 SPARC_Ca_bdg DUF2666 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 67938
NCBI-ProteinID: NP_075891
MGI: 107494
Ensembl: ENSMUSG00000034868
Vega: OTTMUSG00000016301
UniProt: Q3THE2
Position
17; 17 E1.3
AA seq 172 aa AA seqDB search
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaaaagcgaagaccaagaccaccaagaagcgccctcagcgcgcaacctcc
aatgtgttcgccatgtttgaccagtcccagatccaggagttcaaagaggcctttaacatg
attgaccagaaccgggatggcttcattgacaaggaggacctgcacgacatgctggcgtct
ctggggaagaatcccactgatgcctacctggacgccatgatgaacgaggccccgggcccc
atcaatttcaccatgttcctcaccatgtttggggagaagctaaacggcactgaccccgag
gacgtcatcagaaacgccttcgcttgctttgatgaggaagccacaggcaccatccaggag
gattacctgagggagctgctgaccaccatgggcgaccgcttcacagacgaggaagtggat
gagctgtacagagaggcccccattgacaaaaaggggaacttcaactacattgagttcaca
cgcatcctgaagcacggcgcgaaagacaaagatgactga

DBGET integrated database retrieval system