KEGG   Mus musculus (mouse): 67942
Entry
67942             CDS       T01002                                 

Gene name
Atp5g2, 1810041M08Rik, Atp5mc2
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67942 (Atp5g2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    67942 (Atp5g2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67942 (Atp5g2)
   05012 Parkinson disease
    67942 (Atp5g2)
   05014 Amyotrophic lateral sclerosis
    67942 (Atp5g2)
   05016 Huntington disease
    67942 (Atp5g2)
   05020 Prion disease
    67942 (Atp5g2)
   05022 Pathways of neurodegeneration - multiple diseases
    67942 (Atp5g2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67942 (Atp5g2)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 67942
NCBI-ProteinID: NP_080744
MGI: 1915192
Ensembl: ENSMUSG00000062683
Vega: OTTMUSG00000047926
UniProt: P56383
Position
15; 15 F3
AA seq 146 aa
MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDESLSSLAVRRPLTSLIP
SRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSY
AILGFALSEAMGLFCLMVAFLILFAM
NT seq 441 nt   +upstreamnt  +downstreamnt
atgtacgcctgctccaagttcgtctctacccgctccctgatcaggagcacctctctcagg
agcacctctcagctgctgagtcgtccgctgtctgcagtggagttgaagcgaccacagatg
ccaacagatgagagcctcagcagcttggcggtccggcggcctctgacttcacttatccct
agccgcagtttccaaaccagcgccatttcaagggacatcgacacagctgccaagttcatt
ggagctggggctgcgacagttggggtggctggctctggggcagggattgggactgttttt
gggagtctcatcattggctatgccaggaacccttctctgaagcaacaactcttctcctac
gcgattctgggctttgccctctcagaggccatggggctcttttgcctaatggtggccttt
ctcatcctcttcgccatgtga

DBGET integrated database retrieval system