KEGG   Mus musculus (mouse): 67944
Entry
67944             CDS       T01002                                 

Symbol
Tex13a, 1700025D03Rik
Name
(RefSeq) testis expressed 13A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TEX13 zf-RanBP HTH_37 zf-ribbon_3
Other DBs
NCBI-GeneID: 67944
NCBI-ProteinID: NP_080745
MGI: 1915194
Ensembl: ENSMUSG00000071686
Vega: OTTMUSG00000018678
UniProt: A2AFS9
Position
X; X F1
AA seq 377 aa
MALNPEDLGSGFRHSKVSMFINEQMAKHDKGPDFYLENLSLSWEEVEDKFKVILEDSEVS
NEAREACAWGTLALGVRFAHRQGCLQGHGVQWLQDLSSLHKMSALSLSPDLKQLIHQQEM
AQKEVALQLQMAQAKLEEVQRERDLLRLKILQAELRALPNAVRPAVAIPPAVVRRGGIRT
QWSSTKENLAEWMAAATGRPNERANMSDTALSGTITSPEEVLEDPNGSFMKLLGVMKCKN
YPLKRQRLDLRPKKASMCSFSQSLNLRSTVSSEPFIVQLPASFTYSYESPFPAIPTTSQL
PTTERQPHVYPYSMASDISHLSDMRIHRGDHQELPKDKRFSAFRRPGDWDCPWCKAVNFS
RRENCFHCGKGIWLQNP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggccttgaatcctgaggatcttggtagtgggttccggcatagcaaggtgtcaatgttc
atcaatgaacaaatggccaagcacgacaaaggccctgatttctaccttgagaacctgtcc
ctgtcttgggaagaggtggaagacaagttcaaagtcatccttgaggatagtgaggtctct
aatgaggctcgggaagcctgtgcctggggtaccctggccttgggtgtgcgcttcgctcac
aggcaaggctgcttacaagggcatggggtgcagtggctacaagacttgtctagcctacat
aagatgtctgcactctccttgtcaccagacctgaagcagctcatccaccagcaagagatg
gctcagaaggaggtagctctccagcttcaaatggctcaggccaaactagaagaagtgcag
agagagagagacctactgagactgaagatcctccaagcagagctgagggctctcccgaat
gcagtaagaccagctgtggccattcctcccgctgttgtcagaagaggagggataaggaca
caatggtcaagcacaaaggagaacttggcagagtggatggctgctgccacaggaagaccg
aatgagagggcaaatatgagcgacactgccctgtcagggacaataacttccccagaagag
gtcttggaggatcccaatggaagtttcatgaagcttctaggagtcatgaagtgcaaaaat
tatcccctgaaaaggcagagattagatctcagacccaagaaggcatccatgtgctctttc
tctcagtccctaaatctgagatccactgtgtcctctgagccctttattgtccaactccca
gcctcattcacatactcctatgaaagccccttcccagccatacccaccacatcccaacta
ccgaccacagaaagacagcctcatgtgtatccctattctatggcctctgatataagtcat
ctgtctgatatgagaatccacagaggagatcatcaagaactaccaaaagacaagagattt
tcagcattccgtaggcctggggattgggactgtccttggtgtaaagctgtgaatttttca
aggagggaaaactgtttccactgtgggaaggggatttggctgcaaaacccttag

DBGET integrated database retrieval system