KEGG   Mus musculus (mouse): 67963Help
Entry
67963             CDS       T01002                                 

Gene name
Npc2, 2700012J19Rik, AA408070, AU045843, HE1
Definition
(RefSeq) NPC intracellular cholesterol transporter 2
  KO
K13443  Niemann-Pick C2 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    67963 (Npc2)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    67963 (Npc2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    67963 (Npc2)
Transporters [BR:mmu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   67963 (Npc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_DerP2_DerF2
Motif
Other DBs
NCBI-GeneID: 67963
NCBI-ProteinID: NP_075898
MGI: 1915213
Ensembl: ENSMUSG00000021242
UniProt: Q9Z0J0
Position
12; 12 D1
AA seq 149 aa AA seqDB search
MRFLAATILLLALVAASQAEPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNIT
FTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYP
SIKLVVEWKLEDDKKNNLFCWEIPVQITS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttctggccgccacgatcctgctgctggcgctggtcgctgccagccaggcggag
cccctgcacttcaaggactgcggctctaaggtgggagttataaaggaggtgaatgtgagc
ccatgtcccaccgatccctgtcagctgcacaaaggccagtcctacagtgtcaacatcacc
tttaccagcggcactcagtcccagaacagcacggccttggtccacggcatcctggaaggg
atccgggtccccttccctattcctgagcctgacggttgtaagagtggaatcaactgcccc
atccagaaagacaaggtctacagctacctgaataagcttccggtgaagaatgaatacccc
tctataaaactggtggtggaatggaaacttgaagatgacaaaaagaataatctcttctgc
tgggagatcccagttcagatcacaagctag

DBGET integrated database retrieval system