KEGG   Mus musculus (house mouse): 67966
Entry
67966             CDS       T01002                                 
Symbol
Zcchc10, 2410141K03Rik, AA675321, D11Ertd416e
Name
(RefSeq) zinc finger, CCHC domain containing 10
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-CCHC_3
Other DBs
NCBI-GeneID: 67966
NCBI-ProteinID: NP_080755
MGI: 1196228
Ensembl: ENSMUSG00000018239
UniProt: Q9CX48
Position
11:53215516..53224128
AA seq 178 aa
MATPMHRLIARRKAEANKQHVRCQKCLEFGHWTYECKGKRKYLHRPSRTAELKKALKEKE
NRLLLQSIGETNIEKKIKKKKRSKSVTSSSTSSSDSSASESSSESETSASSSSEDSDSDE
SLSSSSSSSSSSACSSSSSSSSSSSSSDSDSSSSSSSSSSSSESSSDDEPQKKKKKKK
NT seq 537 nt   +upstreamnt  +downstreamnt
atggcgactcccatgcatcggctcatagctcgaaggaaagctgaagccaataagcaacat
gtaagatgtcagaaatgcttggaatttggacattggacttatgaatgcaaagggaaaaga
aagtacctacacagaccttcgagaacggcagagctgaagaaagctttaaaagaaaaagaa
aatagattattgctgcaaagcataggagagaccaacatagagaaaaagatcaagaagaag
aagaggtctaagagtgtcacgagttccagtacctctagcagtgacagttcggccagtgag
tcttcatcagagagtgagacatccgcctcatcctcttcagaagacagtgactcagatgaa
agcctctctagctcctcctcctcctcctcttcctcggcctgttcgtcttcctcttcctcc
tcttcctcctcctcctcctcggactcggactccagctcgtccagcagcagcagcagcagc
agttctgagagcagctctgatgatgagccacagaagaagaaaaagaagaagaaatag

DBGET integrated database retrieval system