KEGG   Mus musculus (mouse): 67967Help
Entry
67967             CDS       T01002                                 

Gene name
Pold3, 2410142G14Rik, C85233, P66, P68
Definition
(RefSeq) polymerase (DNA-directed), delta 3, accessory subunit
  KO
K03504  DNA polymerase delta subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Module
mmu_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    67967 (Pold3)
   03410 Base excision repair
    67967 (Pold3)
   03420 Nucleotide excision repair
    67967 (Pold3)
   03430 Mismatch repair
    67967 (Pold3)
   03440 Homologous recombination
    67967 (Pold3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    67967 (Pold3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    67967 (Pold3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    67967 (Pold3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     67967 (Pold3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    67967 (Pold3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      67967 (Pold3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     67967 (Pold3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDC27
Motif
Other DBs
NCBI-GeneID: 67967
NCBI-ProteinID: NP_001355309
MGI: 1915217
Ensembl: ENSMUSG00000030726
Vega: OTTMUSG00000025292
UniProt: Q8BH76
Position
7; 7 E2
AA seq 462 aa AA seqDB search
MAEQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYEYVERKRKENSGAQLHVT
YLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYD
ILKSNLQNCSKFSAIQCAAAVPRAPAESPSSRKYEQSNLQAASEAQASELTTNGHGPPAS
KQASQQPKGIMGMLISKAATKTQDTNKETKPEAREVTSASSAGGKAPGKGSVMSNFFGKA
AMNKLKVNLDSEQAVKEEKTVEQPPVSVTEPKLAAPPAQKKSSRKSEPGKVQQKEKSSRG
KRVDLSDEEAKETEHLKKKRRRIKLPQSDSSEDEVFEDSPEMYEADSPSPPPVSPPPDPM
PKTEPPPVKRSSGETKRRRKRVLKSKTFVDEEGCIVTEKVYESESCTDSEEELKMKPASA
HKPPAAAVKREPREERKGPKKGAAALGKANRQVSITGFFQKK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacagctgtatctagaaaacatagacgagttcgtcacggaccagaacaagatc
gtgacttacaagtggctaagctatacactaggggttcatgttaaccaggccaaacagatg
ctctatgaatatgttgaaaggaaacggaaagaaaattcgggagctcagctgcatgttacc
tacttggtgtctggcagtcttatacagaacggacattcttgccacaaggttgcagtagtg
agagaagataaactggaagcagtgaagtccaagttagctgtgactgccagcatccatgtg
tacagcatccagaaagctatgctaaaggacagtgggcctctgttcaataccgactatgac
atccttaaaagcaatttgcagaactgcagcaagtttagtgccatacagtgtgcagctgca
gtccccagagctcctgcagaatccccatcttccagaaagtatgaacagtcaaatcttcag
gcagcgagtgaggcacaagccagtgagctgactaccaatggccatggtccacctgcctcc
aaacaggcttcccagcagcccaaaggaattatgggaatgttaatctctaaagctgctact
aaaacccaggacaccaacaaggaaaccaaaccagaggcccgagaagtaaccagtgcatct
tctgctgggggcaaagcaccaggaaaagggagtgtgatgagcaacttttttggaaaagct
gcaatgaataaacttaaagtcaatttggattcagaacaagcagtaaaggaagaaaaaaca
gtggagcaacctccagtgtctgtcactgaaccaaagctggcagctcccccagctcagaag
aaatccagcagaaagtccgagcctgggaaggtgcagcagaaggagaaaagcagcaggggc
aagcgagtagacttgtcggatgaggaggcaaaggaaaccgaacacctgaagaaaaagaga
agaagaatcaagcttcctcagtctgatagcagtgaagatgaagtcttcgaagactcccct
gagatgtatgaagcagactcaccatctccacctcctgtatctccacctcctgatcctatg
ccaaaaactgagccccctcctgtcaagcgttcaagtggagaaaccaaaaggagacgaaag
cgtgtactgaaatctaaaacctttgtggatgaagaaggctgcatagtgactgagaaagtc
tatgagagtgagtcctgcacagacagtgaggaggagcttaagatgaagccggcctcagca
cacaaaccccctgctgccgctgtgaaaagggagcccagagaagaacggaagggccccaag
aaaggggctgctgctctgggcaaagccaacagacaagtgtccattactggcttcttccag
aaaaagtaa

DBGET integrated database retrieval system