KEGG   Mus musculus (house mouse): 67968
Entry
67968             CDS       T01002                                 
Symbol
Ooep, 2410146L05Rik, Floped, Moep19, Sddr
Name
(RefSeq) oocyte expressed protein
  KO
K25077  oocyte-expressed protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67968 (Ooep)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      67968 (Ooep)
SSDB
Motif
Pfam: MOEP19
Other DBs
NCBI-GeneID: 67968
NCBI-ProteinID: NP_080756
MGI: 1915218
Ensembl: ENSMUSG00000032346
UniProt: Q9CWE6
Position
9:complement(78284185..78285870)
AA seq 164 aa
MASHTADADAKPDSDSQKLLNVLPVSLRLRTRPWWFPIQEVSNPLVLYMEAWVAERVIGT
DQAEISEIEWMCQALLTVDSVNSGNLAEITIFGQPSAQTRMKNILLNMAAWHKENELQRA
VKVKEVEEFLKIRASSILSKLSKKGLKLAGFPLPLEGRETQMES
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcatcccacacggctgatgctgacgccaagccagactctgactctcagaagctgctt
aacgtcctgcctgtgtccctgagacttcgcactcggccctggtggttcccaattcaggaa
gtcagtaatcctctggtgctctacatggaagcctgggtggcagaaagggtcataggcaca
gaccaagcggaaatctcagaaatagagtggatgtgccaagccctgctgacagtggactcc
gtcaactctgggaacctagctgaaatcaccatctttggacaacccagtgcacagacgcga
atgaaaaatattctcttgaacatggcggcctggcacaaagaaaacgaactccaaagagct
gtgaaggtgaaagaagttgaagagttcttgaaaattcgtgcctcctcaatcctaagcaag
ttaagtaagaaagggctaaaactggctggctttccgcttccgctggagggaagagaaaca
cagatggagtcttaa

DBGET integrated database retrieval system