KEGG   Mus musculus (mouse): 67978
Entry
67978             CDS       T01002                                 

Gene name
Tctn2, 4432405B04Rik, Tect2
Definition
(RefSeq) tectonic family member 2
  KO
K19361  tectonic-2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67978 (Tctn2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   TCTN-B9D complex
    67978 (Tctn2)
Motif
Pfam: DUF1619
Other DBs
NCBI-GeneID: 67978
NCBI-ProteinID: NP_080762
MGI: 1915228
Ensembl: ENSMUSG00000118662
UniProt: Q2MV57
Position
5; 5 F
AA seq 700 aa
MGSLSPLSLLWGLLLLQGVLRPLRGDPVFIPPFIRMSSPEVRATLVGGSEDVAVSLSLLQ
VEEGVLPVPTCGGRRNETVDWNVTVSPRESTLEVTIRWKRGLDWCSADETASFSEPPCVL
QMLLVSASHNASCLAHLLIQVEIYPNTSVTHNASENMTVIPNQVYQPLGPCPCDLTAKAC
DIQCCCDQDCQPEVRELFAQSCFSGVFGGHVSPPSHHHCAVSTTHQTPDWFPLLCVQSPP
STSPFLGHFYHGATSPRHSPGFEAHLHFDLRDFADASYKQGDPIMTTEGYFTIPQVSLAG
QCLQDAPVAFLRNFDSVCTMDLEVHQGRDEIVLENMKIRTTGGPVTPTVTYEEAIDLDKF
ITSPDTVLSVGSAPRNVNVEEHYVFRWQNNSISGLDITVIRAEISAQQRGMMTQRFTVKF
LSHHSGGEKEFSGNPGYQLGKPVRALHTAGMNVSTLHLWQPAGRGLCTAAALRPILFGEN
AFSGCLLEVGIKENCTQLRENVLQRLDLLTQATHVARRGNSDYSDLSDGWLEIIRAEAPD
TGADLPLSSVNGVCPEVPARLSIRILTAEAGSVEGVAQREILAVETRFSTVTWQYQCGLT
CEDKADLLPLSASVEFINVPAQMPHPPTRFQINFTEYDCTRNELCWPQLLYPLTQYYQGE
PQSQCVAKGLMLLSLLMLAILLRHPWVRMCKARDSAAIYH
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgggctctctgtcaccgctcagcctcctgtggggactcctcctgctgcagggcgtcctg
aggccgctgcgcggggacccggttttcatcccacctttcatccggatgtccagccctgag
gtccgagcgaccctggtcggaggcagcgaggatgtcgctgtgtctctgagtctgctgcag
gtcgaggaaggagtgttgccagttcctacttgtggcggccgccgcaatgagacagtggat
tggaatgtgactgtgagcccccgagagagcacgctggaagtgaccataaggtggaagagg
ggtctagactggtgctccgcagacgagacagcctcattctcagagcccccgtgtgttctg
cagatgctgctagtttcagcctcccacaatgcatcctgcttagcacatctgctcatccag
gtggagatttatcccaacacatctgtaacccacaacgcatcagagaacatgactgtcatt
cctaaccaagtctatcagcccctgggtccctgcccgtgtgacttaacagccaaggcctgt
gacattcaatgctgctgtgaccaggactgtcagccagaagtaagagagctgtttgcacag
tcctgcttctccggcgtgtttggagggcacgtcagccctccgtcccatcatcactgcgct
gtcagcactactcaccagactcctgactggtttcccctcctgtgtgtgcagtcgccaccc
tctacctcgccgttccttggtcacttctaccacggtgccacttcccccagacattccccc
ggctttgaagcccatttgcacttcgacctaagagacttcgcggatgccagttacaagcaa
ggagatcccattatgaccacggaggggtattttaccatcccccaggtgtctctagctggg
cagtgtctacaggatgctcctgtggctttcctgaggaattttgacagtgtatgtaccatg
gacctggaagtgcaccaaggacgagatgaaattgtcctcgagaacatgaaaatccgcaca
acaggaggtccggtcacaccaacagtaacctatgaggaagccattgacctggacaagttc
atcaccagcccggacacagttttaagtgtcggatcggcccccagaaacgtgaatgtggaa
gaacattatgtcttcagatggcaaaataattccatcagcggcctagacatcacagtcatc
agggcagaaatcagtgcccagcagagaggaatgatgacccagagattcacagtgaagttt
ttaagccatcacagtggtggtgagaaggaattttctggaaatccaggttaccagcttggc
aagccggtccgagccctgcataccgctgggatgaacgtcagcacactgcacctctggcag
ccagctggaaggggcctgtgcacagcagccgctctcagacccattttgtttggagaaaat
gccttctctggctgcctgctggaagttgggattaaggagaactgtacccagctcagagag
aatgtccttcagagactggatttgctgacacaagcaacgcacgtggcgaggagaggcaac
tcggactacagtgatctgagtgacggctggctggagatcatacgtgccgaagcccctgat
acaggtgccgacctgcccttgagcagcgtgaatggcgtgtgcccagaagttccagcccgg
ctctccatccgcattctcactgctgaagctggctctgtggaaggggtggctcagcgggag
atcctggctgtggagacaaggttttccacagtgacctggcagtaccagtgtgggctcact
tgtgaggacaaggccgaccttctccctctcagtgcctctgttgagttcattaatgtccct
gcgcagatgccccacccccctacgagattccagatcaacttcacagagtacgactgtacc
cggaatgagctgtgttggccccaacttctgtaccctctgacccagtattatcaaggggag
ccccagtctcagtgtgtggccaaaggcctgatgctgctgtcactcctcatgctggccatc
ctcctcaggcacccctgggtcaggatgtgcaaagcccgggactcagctgccatctaccat
taa

DBGET integrated database retrieval system