KEGG   Mus musculus (mouse): 67993
Entry
67993             CDS       T01002                                 

Gene name
Nudt12, 0610016O18Rik
Definition
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 12
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    67993 (Nudt12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    67993 (Nudt12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     67993 (Nudt12)
SSDB
Motif
Pfam: NUDIX Ank_2 Ank_5 Ank_4 Ank_3 Ank zf-NADH-PPase NUDIX-like DNA_ligase_ZBD
Other DBs
NCBI-GeneID: 67993
NCBI-ProteinID: NP_080773
MGI: 1915243
Ensembl: ENSMUSG00000024228
Vega: OTTMUSG00000033656
UniProt: Q9DCN1
Structure
PDB: 
6O3P

Position
17; 17 D
AA seq 462 aa
MSSVKRNPKKEMISELHSSAAEGNVAKLAGILSHSPSLLNETSENGWTALMYAARNGHPD
VVQFLLEKGCDRSLVNKARQTALDIAAFWGYRHIANLLANAKGGKKPWFLTNEVDECENY
FSRTLLDRRSDKRNNSDWLQAKESHPTTVYLLFSDLNPLVTLGGNKESSQQPEVRLCQLN
YPDVKGYLAQPEKITLVFLGVELEMRKGSPAQAGGVPEEEEDGLVAWFALGIEPGAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSATKIEEGGYKR
VCVRETCPSLQGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDAR
WFTREQVVDVLTKGKQQAFFVPPSRAIAHQLIKHWVGMNPNL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcttctgttaaaagaaatcccaaaaaggagatgatttctgaactccacagttcagcc
gcagagggaaatgtcgcaaagttagcaggaatactcagccattctccatctcttctcaat
gagacttctgaaaatggatggactgctttaatgtacgccgccaggaacgggcatcccgat
gtggtccagtttctgcttgagaaaggatgtgacagatcacttgtcaataaagcgaggcaa
accgccctggatattgctgcattttggggttataggcatatagctaacttgttagcaaat
gcaaaaggtgggaagaagccctggttcctaaccaatgaagtagacgagtgtgagaattat
tttagcagaacactactggaccggaggagtgacaaaagaaataattctgactggctgcaa
gctaaagagagccaccccaccacagtttatctccttttctcagacttgaaccccctggtt
accctaggtggtaataaagaaagctcgcagcagccggaagtccggctttgccagctgaac
tacccggatgtaaagggttacttggctcagcctgagaagatcaccttggtgttccttgga
gtcgagcttgagatgaggaaaggctcacccgcccaggcgggaggagtcccagaggaagag
gaggacggtttggttgcttggtttgccctcggtattgaacccggtgctgctgaggagttt
aagcaaagacatgaaaattgttattttctccacccgccaatgccagctcttctgcagttg
aaagaaaaggaggctggggtggtagctcaagcaagatcagtgcttgcctggcatagtcga
tacaagttctgcccaacctgtggcagtgcgactaaaattgaggaaggaggctacaaaaga
gtgtgtgtacgagagacttgccctagtctccaaggcgtccacaacacatcttacccgaga
gttgatccagtcgtaattatgcaggtcatccatccagatggaaccaaatgtcttctaggc
aggcaaaagcgattccccccgggcatgttcacatgtcttgctggatttatagagcccggg
gagacaatagaagatgctgtgcggagagaggtggaagaggaaagtggagtcaaagttggc
catgttcagtatgtctcttgtcaaccatggccaatgccctcctcgttaatgattggctgt
ttagctgtggcagtgtctacagaaattaaagttgacaagaatgaaatagaggatgcccga
tggttcactagagaacaggttgtggacgttcttaccaaagggaagcagcaagcattcttt
gtgccaccaagccgagctatcgcacatcagttaatcaaacactgggtgggaatgaacccc
aatctctaa

DBGET integrated database retrieval system