KEGG   Mus musculus (mouse): 68001
Entry
68001             CDS       T01002                                 

Gene name
Cfap298, 1110004E09Rik
Definition
(RefSeq) cilia and flagella associate protien 298
  KO
K24229  cilia- and flagella-associated protein 298
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    68001 (Cfap298)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    68001 (Cfap298)
Motif
Pfam: CFAP298
Other DBs
NCBI-GeneID: 68001
NCBI-ProteinID: NP_080778
MGI: 1915251
Ensembl: ENSMUSG00000022972
Vega: OTTMUSG00000019913
UniProt: Q8BL95
Position
16; 16 C3.3
AA seq 290 aa
MVVLHVKRGDESQFLLQAPGSTELEELTAQVARVYNGRLKVHRLCSEMEELAEHGVFLPP
NMQGLTDEQIEELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQAPNEKMKQVLKKTVEEAK
AIVSKKQVEAGVFVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAA
LEVIQESEAQLWWAAKELRRTKKLSDYVGKNEKTKIIVKIQQRGQGAPAREPVISSEEHK
QLMLFYHRRQEELKKLEENDDDSCLNSPWADNTALKRHFHGVKDIKWRPR
NT seq 873 nt   +upstreamnt  +downstreamnt
atggttgtgctgcacgtgaagagaggcgacgagagccagttcttactgcaggcgcccggg
agcacggagctggaagagctcacggcgcaggtggcccgcgtctacaacgggcggctgaag
gtgcaccggctctgctcagagatggaggagctggcggaacacggtgtctttctgccccct
aatatgcaagggctgactgatgagcagatcgaagagctgaaactgaaggacgagtggggg
gagaagtgtgtgcccagtggagggtctgtttttacgaaggacgagatcgggcggaggaac
gggcaagctccaaatgagaaaatgaagcaggttttaaagaagacggtagaagaagccaag
gcgatagtgtctaagaaacaagtagaagctggagtctttgttaccatggagatggtgaaa
gatgccttggaccagcttcgaggtgcggtcatgatcgtttatcccatggggctgccacca
tacgatcctatccggatggaatttgaaaataaagaagatttgtcaggaactcaggcagcc
ctcgaagtcatccaggagtcggaggcacagctgtggtgggccgccaaggagctgagaaga
acaaagaagctttctgactatgtggggaaaaatgagaaaaccaaaatcatcgtcaagatc
cagcagagagggcagggtgccccagcccgggagcctgtcatcagcagtgaagaacacaag
cagctgatgctgttctaccacagaagacaggaggagctcaagaaactggaagagaatgac
gatgactcctgtctgaactccccgtgggctgacaacacggctttgaaaagacattttcat
ggcgtaaaagacataaagtggcggcccaggtga

DBGET integrated database retrieval system