KEGG   Mus musculus (mouse): 68009
Entry
68009             CDS       T01002                                 

Symbol
Defa20, 2010016F14Rik, Defcr2, Defcr20
Name
(RefSeq) defensin, alpha, 20
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    68009 (Defa20)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    68009 (Defa20)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    68009 (Defa20)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_beta DUF3316
Other DBs
NCBI-GeneID: 68009
NCBI-ProteinID: NP_899091
MGI: 1915259
Ensembl: ENSMUSG00000095066
Vega: OTTMUSG00000019856
UniProt: Q45VN2
Position
8; 8 A2
AA seq 95 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQPGEEDQAVSVSFGDPEGSALHEKSSR
DLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaggagactaatactgaggagcagccaggggaggaggaccag
gctgtgtctgtctcctttggagacccagaaggatctgctcttcatgaaaaatcgtcgaga
gatctgatatgctattgtagaaaaggaggctgcaatagaggagaacaagtttatgggacc
tgctcaggacgacttttgttctgctgccgccgccgccaccgccactga

DBGET integrated database retrieval system