KEGG   Mus musculus (house mouse): 68010
Entry
68010             CDS       T01002                                 
Symbol
Bambi, 2610003H06Rik
Name
(RefSeq) BMP and activin membrane-bound inhibitor
  KO
K10162  BMP and activin membrane-bound inhibitor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    68010 (Bambi)
   04350 TGF-beta signaling pathway
    68010 (Bambi)
SSDB
Motif
Pfam: BAMBI_C BAMBI Activin_recp
Other DBs
NCBI-GeneID: 68010
NCBI-ProteinID: NP_080781
MGI: 1915260
Ensembl: ENSMUSG00000024232
Position
18:3507011..3516404
AA seq 260 aa
MDRHSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
TNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEA
SGQGNRYQHDSSRNLITKMQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDERQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQAELSNE
KILSLVHWGMYSGHGKLEFI
NT seq 783 nt   +upstreamnt  +downstreamnt
atggatcgccactccagctacttcttcatctggctgcagctggagctctgcgccatggct
gtgctgctcaccaaaggagagatcagatgctactgtgatgctgctcactgtgtggcaaca
ggttacatgtgtaagtctgagcttagtgcctgcttctccagacttctcgatcctcagaac
accaattctccactcacccacggctgcctggactcacttgcaagcacggcagacatctgc
cgagccaaacaggcccaaaaccactctggccctgccatgcccactttggaatgctgtcac
gaagacatgtgcaattatcgaggactgcatgacgtcctctctccttccaagagcgaagcc
tcaggacaaggaaaccggtatcagcatgacagcagcagaaacctcatcactaagatgcag
gagctgacttcctccaaagaactgtggttccgcgcagctgtgatagcggttcccattgct
ggcggactgatcttggtgctgctcattatgttggccttgcgaatgcttcgaagtgagaac
aagaggctgcaggatgagcggcagcagatgctgtcccgtctgcactacagctttcacgga
caccattccaagaaggggcaagttgcaaagttggacttggagtgcatggtgcctgtcagt
gggcaggagaactgctgtctgacctgtgacaaaatgcggcaagcagagctcagtaatgag
aagatcctctcccttgtgcactggggcatgtacagtggtcatggaaagctggaattcata
tga

DBGET integrated database retrieval system