KEGG   Mus musculus (house mouse): 68014
Entry
68014             CDS       T01002                                 
Symbol
Zwilch, 2310031L18Rik
Name
(RefSeq) zwilch kinetochore protein
  KO
K11579  protein zwilch
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    68014 (Zwilch)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     RZZ complex
      68014 (Zwilch)
SSDB
Motif
Pfam: Zwilch DUF6699
Other DBs
NCBI-GeneID: 68014
NCBI-ProteinID: NP_080783
MGI: 1915264
Ensembl: ENSMUSG00000032400
UniProt: Q8R060 G3X9Z0
Position
9:complement(64044426..64080213)
AA seq 596 aa
MDGGHGGMWSRMNRAAEEFYARLRQEFNEEKKGASKDPFIYEADVQVQLISKGQPSLLKT
ILNENDSVFLVEKVVLEKEETSQVEELQSEETAISDLSAGENIRPLALPVGRARQLIGLY
TMAHNPNMTHLKIKQPVTALPPLWVRCDGSDPEGTCWLGAELITTNDIIAGVILYVLTCK
ADKNYSEDLENLKTSHKKRHHVSAVTARGFAQYELFKSDDLDDTVAPSQTTVTLDLSWSP
VDEMLQTPPLSSTAALNIRVQSGESRGCLSHLHRELKFLLVLADGIRTGVTEWLEPLETK
SALEFVQEFLNDLNKLDEFDDSTKKDKQKEAVNHDAAAVVRSMLLTVRGDLDFAEQLWCR
MSSSVVSYQDLVKCFTLILQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGAMDSVPLSGTT
PLQMLLEIGLDKLKKDYISFFVSQELASLNHLEYFISPSVSTQEQVCRVQKLHHILEILV
ICMLFIKPQHELLFSLTQSCIKYYKQNPLDEQHIFQLPVRPAAVKNLYQSEKPQKWRVEL
SNSQKRVKTVWQLSDSSPVDHSSFHRPEFPELTLNGSLEERTAFVNMLTCSQVHFK
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggacggaggccacggcggtatgtggtcgcgaatgaaccgcgcggcggaggagttttat
gctcgtctccggcaggaatttaatgaagagaagaaaggagcctctaaagacccattcatc
tatgaggctgatgtacaagtgcagttgatcagcaaaggccaaccaagtcttctgaaaact
attctaaatgaaaatgactcagtgtttctcgtggaaaaagtggttttggagaaggaagaa
acaagtcaagttgaagaactgcagtctgaagaaactgctatttctgatctctctgctggt
gaaaatattaggccactggccttacctgttgggagagcaaggcagttaattgggctctat
accatggctcacaatcctaatatgactcatctgaagattaagcagccagtgacagccctt
cctcctctttgggtgagatgtgacggttcagatcctgaaggtacctgttggctaggagct
gagcttatcacaacaaatgacatcattgcaggcgttatcctgtatgtgctcacttgtaaa
gctgataaaaattactctgaagatctggaaaatttaaaaacttcacacaagaaaagacat
cacgtgtctgctgtgacagccagaggctttgcccagtatgagctctttaagtctgacgac
ttggatgacactgttgccccatcacaaactacagtcacgctggacctttcctggagccct
gtggatgagatgctccaaacccctcccctgtcttcaactgcagctctgaatatcagagta
caatcaggagagtccagaggttgtctgagtcatcttcacagagaactgaaatttctcctt
gttttagctgatggcatcaggactggtgtaactgaatggcttgagcctctggaaacaaaa
tctgctcttgaatttgttcaggaatttctgaatgacttaaataaactggatgaatttgat
gattctacaaaaaaagataaacaaaaagaggcagtgaaccatgacgcagctgcagttgtc
aggtccatgcttctcaccgtgcggggggatctcgattttgctgaacagctttggtgtaga
atgagcagcagtgtggtttcctatcaagacttggtgaagtgtttcacactcatcctgcag
agtcttcagcgtggtgatatacagccatggttgcacagtggaagtaacagtttactaagt
aaactcattcatcagtcttaccatggagctatggacagtgtccctctctctggaactacc
ccactgcagatgcttttggaaattggtttggacaaactgaagaaagattatatcagcttt
tttgtcagtcaggaacttgcatctttgaatcatttggaatacttcatttctccctcagta
tcgacacaggaacaggtttgccgtgttcagaaactccatcatattcttgaaatcttagtc
atctgcatgcttttcattaaacctcagcatgagcttctcttctctttaacacaatcctgc
ataaaatattataaacaaaatcctcttgatgagcaacacatttttcagttgccagtcaga
ccagctgctgtcaagaatttgtatcaaagtgagaagccgcagaaatggagagtggagctc
agcaatagtcagaagagggtgaaaacagtgtggcaactgagtgacagctcccctgtagac
cattccagtttccacaggcctgagtttcctgagctgacactgaatggtagtctggaagaa
aggacagccttcgttaacatgcttacctgcagccaggtgcacttcaagtaa

DBGET integrated database retrieval system