KEGG   Mus musculus (mouse): 68021Help
Entry
68021             CDS       T01002                                 

Gene name
Bphl, 2010012D11Rik, 5730533B08Rik, AI115341
Definition
(RefSeq) biphenyl hydrolase-like (serine hydrolase, breast epithelial mucin-associated antigen)
  KO
K18399  valacyclovir hydrolase [EC:3.1.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    68021 (Bphl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     68021 (Bphl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 FSH1 BAAT_C LIP Esterase Abhydrolase_4
Motif
Other DBs
NCBI-GeneID: 68021
NCBI-ProteinID: NP_080788
MGI: 1915271
Ensembl: ENSMUSG00000038286
UniProt: Q8R164
Position
13; 13 A3.3
AA seq 291 aa AA seqDB search
MATATVRPAAQRLRLLLSPLKSRICVPQAEPVATFGTAVTSAKVAVNGVHLHYQRVGEGE
HAILLLPGMLGSGKTDFAPQLQSLNKKRFTLVAWDPRGYGYSRPPDRDFPRDFFERDAKD
AVDLMKALQFKQVSLLGWSDGGITALIAAAKYPSYIRKMVIWGANAYVTEEDSRIYQGIR
DVSKWSEKARKPLEALYGYDYLAKTCEDWVDGISQFKQLPEGNICRHLLPLVQCPTLIVH
GEKDPLVPRFHADFLLQHVKGSRLHLMPEGKHNLHLRFADEFNRLVEDFLQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcaacagttcgcccggcggcccagcggttgcggctgctcctctcgcccctg
aaatcccggatctgcgtaccccaggccgaacccgtagccaccttcggcactgcagtaact
tctgccaaggtggctgtgaatggcgttcacctgcattaccagcgcgtgggagaaggggaa
catgcgatcctcctgcttcctgggatgttgggtagcggaaagaccgattttgcacctcag
cttcagagcctaaataagaagcgcttcacattggtggcctgggaccctcgaggatatgga
tattccagacccccagatcgagattttccacgggatttttttgaaagggatgcaaaggat
gctgttgacttgatgaaggctctacagttcaagcaggtctccctcctgggctggagtgat
ggcggcataactgcgctcatcgctgctgcaaagtacccatcttatatccgcaagatggtg
atctggggagcaaatgcctatgtcaccgaggaagacagcaggatttaccagggtatccga
gatgtttctaaatggagtgagaaggcaaggaaacccctggaagccctgtatggatatgac
taccttgccaaaacctgtgaggactgggtggatggcataagccagtttaaacaactgcca
gagggtaacatctgccggcacttgctgcccctggtccagtgccctaccctcattgtgcat
ggggagaaggacccattggtcccccgctttcatgctgacttccttctccagcatgtgaaa
gggtcacggttgcatctgatgccagaaggcaagcacaacttacacttacgctttgcagac
gaattcaacaggttggtagaagactttctacagtga

DBGET integrated database retrieval system