KEGG   Mus musculus (house mouse): 68024
Entry
68024             CDS       T01002                                 
Symbol
H2bc4, 2610022J01Rik, H2bc6, H2bc8, H2bfs, Hist1h2bc, R74621
Name
(RefSeq) H2B clustered histone 4
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    68024 (H2bc4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    68024 (H2bc4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    68024 (H2bc4)
  09165 Substance dependence
   05034 Alcoholism
    68024 (H2bc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    68024 (H2bc4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    68024 (H2bc4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    68024 (H2bc4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   68024 (H2bc4)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 68024
NCBI-ProteinID: NP_001277309
MGI: 1915274
Ensembl: ENSMUSG00000018102
UniProt: Q6ZWY9
Position
13:23868182..23876805
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcctgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcaccccgacaccggcatctcctccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggccgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system