KEGG   Mus musculus (mouse): 68027
Entry
68027             CDS       T01002                                 

Gene name
Tmem178, 2810417M05Rik, Tmem178a
Definition
(RefSeq) transmembrane protein 178
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Claudin_2 PMP22_Claudin Atthog GSG-1
Other DBs
NCBI-GeneID: 68027
NCBI-ProteinID: NP_080792
MGI: 1915277
Ensembl: ENSMUSG00000024245
UniProt: Q9CZ16
Position
17; 17 E3
AA seq 297 aa
MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLM
PLSHLPLRDSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYF
LGIDRDIDTLILKGIAQRCTAIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGF
LGMAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASVSYDLNRVP
KLIYSLPHDVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAHLKSGRDSTV
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagccacgggcgctcgtcacggcgctaagcctcggcctcagcctttgctccctgggg
ctgctcgtcacggccatcttcaccgaccactggtacgagaccgacccccggcgccacaag
gagagctgcgagcgcagccgcgcgggcgccgaccccccggatcagaagaaccgcctgatg
ccgctgtcgcacctgccgctgcgggactcgcctcccctggggcgccggctgctccccggc
ggccccgggcgctcagaccctgagtcctggcgctcgcttctggggcttggcgggttggac
gctgagtgtggccggccactgttcgccacctactcgggcctctggaggaagtgctacttt
ctgggcatcgaccgggacatcgacaccctcatcctgaaaggtattgcacagcgatgcaca
gcaatcaagtaccacttttctcagccaatccgcttaagaaacattcctttcaatttaacc
aagacaatccagcaagatgaatggcacctgcttcatctaagaagaataacagctggcttc
ctgggcatggcggtggctgtcctgctgtgtggctgcattgtggccacggtcagcttcttc
tgggaggaaagcctgacccagcacgtggccggactcctattcctcatgacagggatattt
tgcaccatctcgctctgcacgtacgccgccagtgtctcctatgacttgaaccgggtcccg
aagctaatttacagcctgcctcatgatgtggaacatggctacagctggtccatcttttgt
gcctggtgcagtttaggttttatcgtggcagctggaggtctctgcatcgcttatccgttt
attagccggacgaagattgcacatctaaagtctggcagggactccacggtatga

DBGET integrated database retrieval system