KEGG   Mus musculus (house mouse): 68036
Entry
68036             CDS       T01002                                 
Symbol
Zfp706, 3110006P09Rik, AA793007, AW536850, C77232, Znf706
Name
(RefSeq) zinc finger protein 706
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: 4F5 zf-met Ribosomal_L44 zf-C2H2_12 zf-C2H2_jaz zf-C2H2_4 DUF629
Other DBs
NCBI-GeneID: 68036
NCBI-ProteinID: NP_080797
MGI: 1915286
Ensembl: ENSMUSG00000062397
UniProt: Q9D115 B2RVQ7
Position
15:complement(36997271..37007646)
AA seq 76 aa
MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFES
KHPKTPLPPELADVQA
NT seq 231 nt   +upstreamnt  +downstreamnt
atggctcgtggacagcagaagattcagtctcagcagaaaaatgccaaaaagcaggctgga
caaaagaagaaacaaggacatgaccaaaaggctgctgccaaagctgccttaatatatacc
tgcaccgtctgtaggacacaaatgccagaccccaagaccttcaagcagcactttgagagc
aagcaccctaagactccacttcctccagaattggctgatgttcaggcataa

DBGET integrated database retrieval system