KEGG   Mus musculus (house mouse): 68043
Entry
68043             CDS       T01002                                 
Symbol
Eef1akmt1, 2510005D08Rik, AW045965, Ayu21-96, Gt(pU21)96Imeg, GtAyu21-96, N6amt2
Name
(RefSeq) EEF1A alpha lysine methyltransferase 1
  KO
K22855  EEF1A lysine methyltransferase 1 [EC:2.1.1.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    68043 (Eef1akmt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     68043 (Eef1akmt1)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    68043 (Eef1akmt1)
SSDB
Motif
Pfam: N6-adenineMlase Cons_hypoth95
Other DBs
NCBI-GeneID: 68043
NCBI-ProteinID: NP_080802
MGI: 1915293
Ensembl: ENSMUSG00000021951
UniProt: Q9CY45 A0A0D2X7Z2
Position
14:complement(57787052..57809039)
AA seq 214 aa
MSESEDDDIPQLSSHTLAALQEFYAEQKQSVNPRGDDKYNVGVIEENWQLSQFWYSQDTA
LRLAREAIDAAGEGGRIACVSAPSVYQKLRELCREDSSVYIFEYDRRFAIYGDEFIFYDY
NHPLELPERIAAHSFDLVVADPPYLSEECLRKTSETIQFLTRGKILLCTGAIMEEQAAQL
LGVKMCKFIPEHSRNLANEFRCYTNYDSGLDCEA
NT seq 645 nt   +upstreamnt  +downstreamnt
atgagtgagtcagaagacgacgacataccccagctctcttcccataccttagcagctctc
caggagttttatgctgagcagaagcaatccgtcaaccccagaggggatgataaatataac
gttggggtaatagaggagaactggcagctgagccagttctggtacagtcaggacactgct
ttgcgacttgcacgggaagcgatcgatgctgctggagaaggaggcagaatcgcgtgtgtg
agcgcgccaagcgtgtaccagaagctccgggagctctgtagggaagacagctctgtctac
atctttgaatacgacagaagattcgccatatatggggatgaatttatcttctatgattac
aaccatccactggagttgcctgagagaatcgctgcgcatagctttgaccttgtggttgca
gaccctccttacctgtctgaggaatgtctcaggaagacatctgaaacgatccagtttctg
actcggggcaagattctgctgtgcacaggagccatcatggaagagcaggcagctcagctc
ctgggtgtgaagatgtgcaagtttattccggaacactcccgaaacttggccaatgagttc
cgctgttacacgaactatgactctgggctggactgtgaagcctaa

DBGET integrated database retrieval system