KEGG   Mus musculus (mouse): 68048Help
Entry
68048             CDS       T01002                                 

Gene name
Aen, 2700083B06Rik, Isg20l1
Definition
(RefSeq) apoptosis enhancing nuclease
  KO
K18340  apoptosis-enhancing nuclease [EC:3.1.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    68048 (Aen)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     68048 (Aen)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    68048 (Aen)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_T DNA_pol_A_exo1
Motif
Other DBs
NCBI-GeneID: 68048
NCBI-ProteinID: NP_080807
MGI: 1915298
Ensembl: ENSMUSG00000030609
Vega: OTTMUSG00000025063
UniProt: Q9CZI9
Position
7; 7 D2
AA seq 336 aa AA seqDB search
MVAGEVPESTQCPSLTSLNTKDVVRRRHKRRSRQHQRFMARKALLQEQELLSTAPGPGLC
LLPSPSQMPAVTEASDSRRQRPKARSGSNGLCSKKSVPREAPRPGPIKCVAIDCEMVGTG
PQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGITRQHMHKAIPFQVAQKEI
LKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVPNLLSQPSSLIRTRVSLKDLALNL
LHKKIQVGHQGHSSVEDAMTAMELYQLVEVQWEQQVASSAQAPAEDRGPDSSTDVEQYMD
DQYWPEDLTQSTGAETNGGPDRQEGEEGQGARSAPP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaggggaagtccccgagtctactcagtgtccatctctcaccagcctgaatacc
aaggatgtggttcggagaagacacaagaggagaagccggcagcaccagcgattcatggcc
cgcaaggccttgcttcaggagcaggagctgttgagcacggcaccagggccaggtctctgc
cttctgccttcaccatcacagatgccagcggtcacagaggcttcggacagcaggaggcaa
cgtcccaaggccaggtccggcagcaatggcctgtgcagcaaaaagtctgtccccagagaa
gctccaagacctgggcccatcaagtgtgtggccattgactgtgagatggtgggtacgggc
ccccaaggacgggtgagcgagctagcccgctgctctgtggtgagctacagtggtgacgtt
ctctatgacaaatacatccggcctgaaatgcccattgtggactatcgcacccgctggagt
ggcatcacccgccagcacatgcacaaggctatcccctttcaggtggcccagaaggagatc
cttaagctgttgaagggcaaggtggtggtggggcacgcactgcacaatgacttccaggcc
ctgaagtacgtccaccctcggagccagacccgggataccacttatgtcccaaacctgctc
agccagcccagctcccttatccgaactcgggtctctcttaaggacctggccttgaacctg
ctgcacaagaagatccaggtcggtcaccagggccactcatctgtggaagatgccatgaca
gccatggagttgtaccagctggtggaggtgcagtgggagcagcaagtggccagctctgcc
caggcccctgctgaggacagggggcccgacagcagcactgacgtggagcagtacatggac
gaccagtactggcccgaggacctgacccagagcaccggggccgagacaaatggaggccca
gatagacaggagggagaggaagggcagggagccaggagtgctcctccctag

DBGET integrated database retrieval system