KEGG   Mus musculus (mouse): 68050Help
Entry
68050             CDS       T01002                                 

Gene name
Akirin1, 6330407G11Rik
Definition
(RefSeq) akirin 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PET10
Motif
Other DBs
NCBI-GeneID: 68050
NCBI-ProteinID: NP_075912
MGI: 1915300
Ensembl: ENSMUSG00000023075
Vega: OTTMUSG00000008998
UniProt: Q99LF1
Position
4; 4 D2.2
AA seq 191 aa AA seqDB search
MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPLQMQTPPASLQQP
APPGSERRLPTPEQIFQNIKQEYNRYQRWRHLEVVLSQSEACTSETQPSSSALTAPGSPG
AFWMKKDQPTFTLRQVGIICERLLKDYEDKVREEYEQILSTKLAEQYESFVKFTHDQIMR
RYGTRPTSYVS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcggggcgacactgaagcggcccatggagttcgaggcggcgctgctgagcccc
ggttccccgaagcggcgacgctgcgcccctctgcccggccccactccgggcctcaggccc
ccggacgccgagccgccgccgcttcagatgcagacgccgccggcgagcctccagcagcct
gccccacccggcagcgagcgtcgtcttccaactcccgagcaaatttttcagaacataaaa
caagaatataatcgttaccagagatggagacatttagaagttgttctcagtcaaagcgaa
gcctgtacttcagaaactcagccttcctcctcggcacttactgcaccaggttctccaggt
gctttctggatgaagaaggaccagcccacctttacccttcgacaagtggggataatatgt
gagcgtctcttaaaagactatgaagataaagtccgagaggagtatgagcaaatcctcagt
accaaactcgcagaacagtatgaatcgtttgtgaaattcacgcatgatcagatcatgcgg
cgatacgggacaaggccaacaagctatgtatcctga

DBGET integrated database retrieval system