KEGG   Mus musculus (house mouse): 68089
Entry
68089             CDS       T01002                                 
Symbol
Arpc4, 20kDa, 5330419I20Rik, AI327076, p20-Arc
Name
(RefSeq) actin related protein 2/3 complex, subunit 4
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu04530  Tight junction
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    68089 (Arpc4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    68089 (Arpc4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    68089 (Arpc4)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    68089 (Arpc4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    68089 (Arpc4)
   05135 Yersinia infection
    68089 (Arpc4)
   05100 Bacterial invasion of epithelial cells
    68089 (Arpc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68089 (Arpc4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    68089 (Arpc4)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    68089 (Arpc4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     68089 (Arpc4)
SSDB
Motif
Pfam: ARPC4 Sm_like Cmr7A
Other DBs
NCBI-GeneID: 68089
NCBI-ProteinID: NP_080828
MGI: 1915339
Ensembl: ENSMUSG00000079426
UniProt: P59999
Structure
Position
6:113355074..113367408
AA seq 168 aa
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEK
VLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITN
FHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
NT seq 507 nt   +upstreamnt  +downstreamnt
atgactgccactctccgcccctaccttagtgccgtgcgggccacgctgcaggctgctctc
tgcctggagaacttctcctcccaggtcgtggaacgacacaacaagccagaggtcgaagtc
aggagtagcaaagaactgctattacagcctgtcaccatcagcaggaatgagaaggaaaag
gttcttattgaaggctccatcaactctgtccgggtcagcattgctgtgaagcaggccgat
gaaattgagaagattttatgccataaattcatgcgcttcatgatgatgcgagcagagaac
ttctttatccttcgaaggaaacctgtggagggatatgacatcagctttctcatcaccaac
ttccacacggagcagatgtacaaacacaagctggtggactttgtaatccacttcatggag
gagatcgacaaggagatcagtgagatgaagctgtcggtcaatgcccgggctcgtatcgta
gctgaggagttcctcaagaatttttaa

DBGET integrated database retrieval system