KEGG   Mus musculus (mouse): 68090
Entry
68090             CDS       T01002                                 

Symbol
Yif1a, 5330422J23Rik, 54TM, Yif, Yif1, Yif1p
Name
(RefSeq) Yip1 interacting factor homolog A (S. cerevisiae)
  KO
K20362  protein transport protein YIF1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68090 (Yif1a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    68090 (Yif1a)
SSDB
Motif
Pfam: YIF1
Other DBs
NCBI-GeneID: 68090
NCBI-ProteinID: NP_080829
MGI: 1915340
Ensembl: ENSMUSG00000024875
UniProt: Q91XB7
Position
19; 19 A
AA seq 293 aa
MAYHSAYGVHGSKHRTRAAPDPPPLFDDTSGGYSSQLGGYPAPGADVAFSVNNLLGDPVA
NMAMAYGTSIASQGKDIVHKELHRFVSVNKLKYFFAVDTAYVAKKLGLLVFPYTHQNWKM
QYSHDVPLPPRKDLNAPDLYIPTMAFITYVLLAGMALGIQQRFSPEVLGLCASTALVWVF
MEVLALLLGLYLATVRSELSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSA
LMYFIVRSLRTAASGPDSMGGPAPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR
NT seq 882 nt   +upstreamnt  +downstreamnt
atggcttaccattcggcatatggagtccacggttccaagcataggacccgggcagctcca
gaccctcctccactcttcgatgatacaagtggtggttattccagccaactgggcggatac
ccagccccaggagctgatgtagccttcagtgtcaacaacctgcttggagacccagtggcc
aatatggcaatggcctatggcacctccatagcatcccaagggaaggacatagtgcacaaa
gagctgcaccgttttgtgtccgtgaacaaactcaagtatttttttgctgtggacacagcc
tatgtcgctaagaagctagggctattggtcttcccatacacacatcagaactggaaaatg
caatacagccatgatgtgcctctgcccccgcggaaagatctcaatgcccctgacctctat
atccccaccatggccttcatcacatacgtgctgctggctggaatggcgctaggcattcag
caaaggttctccccagaggtgttgggcctgtgtgcaagcacagcactggtgtgggtgttc
atggaggtgttggctctgcttctgggcctctacctggccaccgtacgcagtgaactgagt
accttccacctcttggcttacagcggttacaaatatgtggggatgatccttagtgtgctc
acggggctgctcttcggcagtgatggctactacgtggccctggcctggacatcatctgcg
cttatgtacttcattgtacgatctttgcggactgcagcttcaggccctgacagcatgggg
ggcccagcccctcggcagcgtctccagctctacctgaccctgggagcagctgccttccag
cccctcatcatatactggctgaccttccacctggtccggtga

DBGET integrated database retrieval system