KEGG   Mus musculus (house mouse): 68097
Entry
68097             CDS       T01002                                 
Symbol
Dynll2, 1700064A15Rik, 6720463E02Rik, C87222, DLC8, DLC8b, Dlc2
Name
(RefSeq) dynein light chain LC8-type 2
  KO
K10418  dynein light chain LC8-type
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    68097 (Dynll2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    68097 (Dynll2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    68097 (Dynll2)
   04812 Cytoskeleton proteins [BR:mmu04812]
    68097 (Dynll2)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Dynein arm
   68097 (Dynll2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     68097 (Dynll2)
SSDB
Motif
Pfam: Dynein_light DUF6702 Nop Ectatomin
Other DBs
NCBI-GeneID: 68097
NCBI-ProteinID: NP_001161943
MGI: 1915347
Ensembl: ENSMUSG00000020483
UniProt: Q9D0M5
Structure
Position
11:complement(87870351..87892746)
AA seq 89 aa
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtctgaccggaaggcagtgatcaagaacgcagacatgtctgaggacatgcaacaggat
gccgttgactgtgccacacaggccatggagaagtacaacatagagaaggacattgctgcc
tatatcaagaaggaatttgacaagaaatataaccctacctggcattgtatcgtgggccgg
aattttggcagctatgtcacacacgagacaaagcacttcatctatttttacttgggtcaa
gttgcaatcctcctcttcaagtcgggctag

DBGET integrated database retrieval system