KEGG   Mus musculus (mouse): 68098
Entry
68098             CDS       T01002                                 

Gene name
Rchy1, ARNIP, CHIMP, PRO1, Pi, Pirh2, Zfp36, Zfp363, Znf363
Definition
(RefSeq) ring finger and CHY zinc finger domain containing 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04115  p53 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    68098 (Rchy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    68098 (Rchy1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    68098 (Rchy1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    68098 (Rchy1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     68098 (Rchy1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    68098 (Rchy1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX zf-C3HC4_3 Prok-RING_4 zf-RING_11 zf-rbx1
Other DBs
NCBI-GeneID: 68098
NCBI-ProteinID: NP_080833
MGI: 1915348
Ensembl: ENSMUSG00000029397
Vega: OTTMUSG00000020371
UniProt: Q9CR50
Structure
PDB: 
2ECM 2DKT

Position
5; 5 E2
AA seq 261 aa
MAATAREDGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEV
QCINCEKLQHAQQTCEDCSTLFGEYYCSICHLFDKDKRQYHCESCGICRIGPKEDFFHCL
KCNLCLTTNLRGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKC
KLCDSYNTAQAGGRRVPVDQQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcggcgacggcgcgggaagatggcgtccgcaacctggcgcaggggccgcggggctgc
gagcactatgacagagcttgtctcctcaaggcaccttgttgtgacaagctttatacctgc
cggctgtgtcacgataccaatgaagatcatcagctagatcgtttcaaagtcaaggaagtg
cagtgcatcaactgtgaaaaactccaacatgcccagcagacttgtgaagactgtagcaca
ttgtttggagaatattactgcagtatttgccacctgtttgacaaagataagaggcagtac
cactgtgagagctgtgggatttgtaggattggtccaaaggaagattttttccattgcttg
aaatgtaatttatgcctaaccacgaatcttcgaggaaaacacaagtgtattgaaaatgtt
tcccggcagaattgtccaatatgcttggaggacattcacacctcccgtgttgttgctcac
gtcttgccgtgtgggcatctcctacatagaacgtgttatgaagaaatgttgaaagaaggt
tacagatgcccattgtgtatgcattctgccttagacatgactcggtactggagacaacta
gatactgaggtagcacagactcccatgccatccgaataccagaacgtgactgttgacatt
ctctgcaatgactgtaatggacgatccacagtccagttccatatcttaggcatgaaatgt
aagctttgtgactcctacaatactgcccaagctggaggccgtagagtgccagtggatcag
cagtga

DBGET integrated database retrieval system