KEGG   Mus musculus (mouse): 68099
Entry
68099             CDS       T01002                                 

Symbol
Cibar1, 6720467C03Rik, Fam9, Fam92a, Fam92a1
Name
(RefSeq) CBY1 interacting BAR domain containing 1
  KO
K23868  protein FAM92
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    68099 (Cibar1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    68099 (Cibar1)
SSDB
Motif
Pfam: FAM92 Vps5 P4Ha_N
Other DBs
NCBI-GeneID: 68099
NCBI-ProteinID: NP_080834
MGI: 1915349
Ensembl: ENSMUSG00000028218
Vega: OTTMUSG00000004598
UniProt: Q8BP22
Position
4; 4 A1
AA seq 355 aa
MPSGLPCPALDRRGARRVATETPGRRGGAHCALSAPGRSGGVACSRAPWRPGAALVGLPS
WVPGGGKGKMLRRNLDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLL
VNEINLYASTETPNLKQGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRD
DLKATLTARNREAKQLSQLERTRQRNPSDRHVISQAETELQRATIDATRTSRHLEETIDN
FEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSLYLSDYP
SRLDIVRANSKSPLQRSLSTKCTSGTGQISTCRTRKDQQVEDEDDEELDVTEDEN
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgccctctggtctcccttgccctgctcttgaccgccggggcgcgcgccgcgtcgccacg
gaaacgccgggcaggcggggcggcgcgcactgcgcgctctcagctcccggtagaagtggc
ggcgtcgcctgctcccgcgcgccctggcggcccggagccgcgctcgttgggctcccatcc
tgggtcccgggcggcgggaaaggcaagatgttgaggcgcaatctggatgagcgagatgct
caaacaaaacaactgcaggatgctgtcacaaatgtggagaagcattttggagagctttgc
caaatctttgctgcttatgtacggaaaactgccaggcttcgagacaaagccgacctccta
gtgaacgaaatcaacctgtatgcctctaccgagacaccaaatttaaagcagggtctgaaa
gactttgctgatgagtttgccaaacttcaagattatcgccaggcagaggttgaaagactt
gaagccaaagtagttgaacctttgaaagcttatgggaccattgtaaagatgaagcgagat
gatctcaaagcaacattaacagcaaggaatcgagaagccaaacagctatctcagttagaa
aggacacgccagcgaaacccatctgatcgacatgtaatttcgcaggcagaaactgaatta
cagagagccacgattgatgctacccgcacaagtcgtcatttggaggaaactattgacaat
tttgaaaagcagaaaataaaggacataaagaacatattatctgagttcatcacaattgaa
atgttatttcatggaaaagccttagaggtcttcactgctgcctaccaaaatatacaaaac
attgatgaggatgaagacctagaggttttccgaaattctctgtatctatcagattatcca
tctcgcttagatattgtaagagcaaattcaaagtcacctcttcagagatcattgtcaact
aagtgcacatctggaactggacagatatccacctgccgaacaaggaaggaccaacaagta
gaagatgaagatgatgaagaattagatgttacagaagatgaaaactaa

DBGET integrated database retrieval system