KEGG   Mus musculus (mouse): 68118
Entry
68118             CDS       T01002                                 

Gene name
Atg101, 9430023L20Rik, AA407441, AU022967
Definition
(RefSeq) autophagy related 101
  KO
K19730  autophagy-related protein 101
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04211  Longevity regulating pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    68118 (Atg101)
   04136 Autophagy - other
    68118 (Atg101)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    68118 (Atg101)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68118 (Atg101)
   05014 Amyotrophic lateral sclerosis
    68118 (Atg101)
   05016 Huntington disease
    68118 (Atg101)
   05017 Spinocerebellar ataxia
    68118 (Atg101)
   05022 Pathways of neurodegeneration - multiple diseases
    68118 (Atg101)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68118 (Atg101)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    68118 (Atg101)
SSDB
Motif
Pfam: ATG101
Other DBs
NCBI-GeneID: 68118
NCBI-ProteinID: NP_080842
MGI: 1915368
Ensembl: ENSMUSG00000037204
UniProt: Q9D8Z6
Position
15; 15 F1
AA seq 218 aa
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGIQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMSRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITEALGTSVTTTMRRLIKDTLAL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaactgtcgatcagaagtgctggaggtgtcggtggaggggcggcaggtggaggaggcc
atgctggcggtgctgcacacggtgctcctgcaccgcagcacgggcaagtttcactacaag
aaggagggcacgtactccataggcaccgtgggcatccaggatgtagactgtgacttcatc
gacttcacctatgtgcgcgtctcctcagaggagctggaccgtgccttgcgcaaggttgtt
ggggaattcaaggatgcactgaggaactcaggtggtgatggcctgggccagatgtccttg
gaattctatcagaagaaaaagtctcgatggcctttttcggatgagtgcatcccctgggag
gtgtggactgtcaaggtgcacgtggtagccttggccacagagcaggagcggcagatatgc
agggagaaggtgggcgagaagctgtgcgagaagatcattaacatcgtggaggtgatgagc
cggcatgagtacctgcccaagatgcccacgcagtcagaggtggacaacgtgtttgacacg
ggcctgcgggacgtgcagccctacctctacaagatctcctttcagatcaccgaggccctg
ggcacctcagtcaccaccaccatgcgcaggctcatcaaagacacccttgccctgtag

DBGET integrated database retrieval system