KEGG   Mus musculus (mouse): 68135
Entry
68135             CDS       T01002                                 

Gene name
Eif3h, 1110008A16Rik, 40kD, 9430017H16Rik, EIF3-P, EIF3-P40, EIF3-ga, EIF3-gamma, Eif3, Eif3s3
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit H
  KO
K03247  translation initiation factor 3 subunit H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    68135 (Eif3h)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    68135 (Eif3h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    68135 (Eif3h)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    68135 (Eif3h)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    68135 (Eif3h)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   68135 (Eif3h)
SSDB
Motif
Pfam: eIF3h_C JAB
Other DBs
NCBI-GeneID: 68135
NCBI-ProteinID: NP_542366
MGI: 1915385
Ensembl: ENSMUSG00000022312
UniProt: Q91WK2 Q5M9L0
Position
15; 15 C
AA seq 352 aa
MASRKEGTGSTATSSGSAGGAVGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGT
EVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWY
QSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEK
DFSPEALKKASITFEHMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLG
KSLQLLMDRVDEMSQDIIKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEED
LSKLFKPHQAPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcgtcgcgcaaggaaggcaccggctctaccgccacctcctccggttctgctggcggc
gcggtggggaagggcaaaggcaaaggcggctccggagattcggccgtgaagcaggtgcag
atcgacggcctggtagtattaaagataatcaaacattatcaagaagaaggacaaggcact
gaggttgttcagggcgtgctcctgggtctggttgtggaagaccggctagagattaccaac
tgcttcccgttcccccagcacacggaggatgatgctgactttgatgaggtacagtatcag
atggagatgatgcgcagccttcgccatgtcaacattgatcacctccacgtgggctggtat
cagtccacatattacggctccttcgttacccgggcgcttctggattctcagttcagctac
cagcacgccattgaagagtctgtcgtcctcatttatgatcccataaaaactgcccaagga
tctctctcgctgaaggcgtacagactgactcctaaactgatggaagtttgtaaagagaag
gacttttcccctgaagcattgaaaaaggcaagcatcacctttgagcacatgtttgaagaa
gtgccgattgtaattaaaaactcacatctgatcaatgtccttatgtgggaacttgagaag
aagtcagctgtggcggataagcacgaattgctcagtcttgctagcagcaatcatctgggg
aagagcctccagctgctgatggaccgggtggacgaaatgagccaggacataatcaaatac
aacacgtacatgcgcaacaccagtaagcagcagcagcagaaacatcagtatcagcagcgt
cgccaacaggagaatatgcagcgacagagtcgaggcgagcccccactccctgaggaggac
ctctctaaactcttcaagccccaccaggcccctgccaggatggattcactgctcattgca
ggccagattaacacttactgccagaacatcaaggagttcactgcccaaaacttaggcaaa
ctcttcatggcccaggctcttcaagaatacaataattaa

DBGET integrated database retrieval system