KEGG   Mus musculus (house mouse): 68172
Entry
68172             CDS       T01002                                 
Symbol
Rpl39l, 4930517K11Rik
Name
(RefSeq) ribosomal protein L39-like
  KO
K02924  large subunit ribosomal protein L39e
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03010  Ribosome
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    68172 (Rpl39l)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    68172 (Rpl39l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    68172 (Rpl39l)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    68172 (Rpl39l)
  Archaea
    68172 (Rpl39l)
SSDB
Motif
Pfam: Ribosomal_L39
Other DBs
NCBI-GeneID: 68172
NCBI-ProteinID: NP_080870
MGI: 1915422
Ensembl: ENSMUSG00000039209
Position
16:9988061..9992775
AA seq 51 aa
MASHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIMYNSKRRHWRRTKLGL
NT seq 156 nt   +upstreamnt  +downstreamnt
atggcttctcacaagaccttcaggatcaagcgattcctggccaagaaacaaaagcaaaat
cgtcccattccacaatggattcagatgaaaactggcaataaaatcatgtacaactccaag
cggagacattggagacgaaccaaattgggtctataa

DBGET integrated database retrieval system