KEGG   Mus musculus (house mouse): 68194
Entry
68194             CDS       T01002                                 
Symbol
Ndufb4, 0610006N12Rik, 1300010H20Rik, CI-B15
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit B4
  KO
K03960  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68194 (Ndufb4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68194 (Ndufb4)
  09159 Environmental adaptation
   04714 Thermogenesis
    68194 (Ndufb4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    68194 (Ndufb4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68194 (Ndufb4)
   05012 Parkinson disease
    68194 (Ndufb4)
   05014 Amyotrophic lateral sclerosis
    68194 (Ndufb4)
   05016 Huntington disease
    68194 (Ndufb4)
   05020 Prion disease
    68194 (Ndufb4)
   05022 Pathways of neurodegeneration - multiple diseases
    68194 (Ndufb4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68194 (Ndufb4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68194 (Ndufb4)
SSDB
Motif
Pfam: NDUF_B4 Phage_holin_2_4
Other DBs
NCBI-GeneID: 68194
NCBI-ProteinID: NP_080886
MGI: 1915444
Ensembl: ENSMUSG00000022820
UniProt: Q9CQC7
Structure
Position
16:complement(37467964..37474730)
AA seq 129 aa
MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHI
EDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGK
LDRKFNISY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcgggttccaagtataagcctgcgcccctggccactctccccagtaccctcgaccct
gccgagtatgacgtgtctccggagaccagaagggcgcaggtcgagcgcttgagcataagg
gcccggcttaaacgggagtatctgcttcagtacaacgaccccaaacgcgtgtcgcacatc
gaggatcctgccttgattcgctggacctatgcaagatcagcaaatatttatcctaatttc
aggcccactcccaagaactcacttttaggagctgtggcagggtttgggcccctcatcttc
tggtattatgttttcaaaacagacagggacagaaaggaaagacttatccaggaaggaaaa
ctggacagaaaatttaacatctcctactaa

DBGET integrated database retrieval system