KEGG   Mus musculus (mouse): 68209
Entry
68209             CDS       T01002                                 

Gene name
Rnaseh2c, 1500026D16Rik, AYP1
Definition
(RefSeq) ribonuclease H2, subunit C
  KO
K10745  ribonuclease H2 subunit C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    68209 (Rnaseh2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    68209 (Rnaseh2c)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    68209 (Rnaseh2c)
SSDB
Motif
Pfam: RNase_H2_suC
Other DBs
NCBI-GeneID: 68209
NCBI-ProteinID: NP_080892
MGI: 1915459
Ensembl: ENSMUSG00000024925
Vega: OTTMUSG00000020425
UniProt: Q9CQ18
Structure
PDB: 
3P5J 3KIO

Position
19; 19 A
AA seq 166 aa
MKNPEEAADGKQRIHLRPGSLRGAAPAKLHLLPCDVLVSRPAPVDRFFTPAVRHDADGLQ
ASFRGRGLRGEEVAVPPGFAGFVMVTEEKGEGLIGKLNFSGDAEDKADEAQEPLERDFDR
LIGATGSFSHFTLWGLETVPGPDAKVHRALGWPSLAAAIHAQVPED
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaagaacccggaggaagcggcagacgggaaacagcgtattcacctgcgccctggctcg
ctgcgtggtgccgcaccggctaagctgcacctcctgccctgcgacgttctagtcagccgg
ccggccccggtagatcgcttcttcacgcccgccgtccgccacgatgcagacgggctacag
gcgtcgtttcgcggtcgcggcctgcggggcgaggaggtagctgtgccgccagggtttgcg
ggattcgtgatggtgacggaggagaagggagaggggttgatagggaaactgaacttctcc
ggggacgcggaggacaaagcggacgaggcgcaggagccgctggagcgggacttcgaccgc
cttatcggggccaccggcagcttcagccatttcaccttgtggggtctggaaacggtcccg
ggtccagatgccaaagtgcatagggccctaggttggcccagcctcgcagcagcgattcac
gcccaggtccctgaggactga

DBGET integrated database retrieval system