KEGG   Mus musculus (mouse): 68215Help
Entry
68215             CDS       T01002                                 

Gene name
Fam98b, 2610510H03Rik
Definition
(RefSeq) family with sequence similarity 98, member B
  KO
K15434  protein FAM98B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    68215 (Fam98b)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing ligases
    68215 (Fam98b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2465
Motif
Other DBs
NCBI-GeneID: 68215
NCBI-ProteinID: NP_080896
MGI: 1915465
Ensembl: ENSMUSG00000027349
Vega: OTTMUSG00000014826
UniProt: Q80VD1
Position
2; 2 E5
AA seq 429 aa AA seqDB search
MRGPELGPETSMEGDVLDTLEALGYKGPLLEEQALSKAAEGGLSSPEFSELCIWLGSQIK
SLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLVSGDIKERLTKKDDCLKLLLFL
STELQALQILQKKKHKNSQLDKNSEICQEVQAVCDALGVPKSDTSDIPLLLSQVESKVKD
ILCRVQKNHVGKPLLKVDLSSEQAEKLERINDALSCEYECRRRMLMKRLDVTVQSFGWSD
RAKAKTDNIARIYQPKRYALSPKTTVTLAHLLAAREDLSKIIRTSSGISREKTACAINKV
LMGRVPDRGGRPNEIEPPPPEMPPWQKRQEGGGRGGWGGGGGGRGGGGGGRGGWGGGGGW
GGGGGSGGGWGGSGGGGGGRGGFQGRGDYGGRGDYGGRGGYGGRGGYGGRGYGDPYGGGG
GGGGGYRRY
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagagggccagagctcgggcccgaaaccagcatggaaggggacgttctggacaccttg
gaggcgctggggtataaggggccactgttagaggaacaggcactctccaaggcagcagag
ggtggactgtcttcacctgagttttcagagctctgcatttggttaggctcccagataaag
tccttatgcaacctggaagaaagcatcacttcagctgggagagatgacctagagagcttc
cagcttgagataagtgggtttttaaaagagatggcctgtccatactcggtactcgtctca
ggagacattaaagagcgcctcacaaagaaggatgactgcttgaaacttctgttgttttta
agtacagaacttcaagctttacaaatattacagaagaaaaaacataaaaattctcagtta
gataaaaatagtgaaatttgccaggaagttcaagctgtatgtgatgccctcggggtcccc
aagtctgacacttcagacattccacttctgctgagccaagtggagtcaaaggtgaaggat
attctctgtagagtccagaaaaaccatgtgggaaagccattgctaaaggttgatttaagt
tctgaacaggcagaaaaactggaaagaattaatgatgctctttcctgtgaatatgagtgt
cgccgacggatgttaatgaaacgattggatgtgacagtgcagtcctttggatggtccgat
agagcaaaggcaaaaacagataacatagcaagaatttaccagcccaagcgttatgctctg
tcgcccaagacaacagtcacattggcacatctgcttgccgcccgtgaagatctgtccaag
atcatcaggacaagcagcggtatcagccgggagaagactgcgtgcgccattaataaggtg
cttatgggacgggtgcctgacaggggaggacggccgaatgaaattgaaccaccaccccct
gaaatgcccccttggcagaagagacaagaaggcggagggaggggtggttggggtggtgga
ggtggtggtagaggaggtggtgggggtggaagaggtggatggggtggtgggggagggtgg
ggagggggaggaggaagtggaggagggtggggaggaagtggtgggggagggggtggccga
ggaggtttccaaggcaggggcgattatggtgggaggggagattatggtggaagagggggc
tatggtgggagagggggctatggtgggagaggttatggagatccatatggaggaggaggt
ggtggtggtggtgggtatagaagatattaa

DBGET integrated database retrieval system