KEGG   Mus musculus (mouse): 68229Help
Entry
68229             CDS       T01002                                 

Gene name
Spindoc, 1700105P06Rik, AI846148, SPIN-DOC
Definition
(RefSeq) spindlin interactor and repressor of chromatin binding
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_12 zf-BED
Motif
Other DBs
NCBI-GeneID: 68229
NCBI-ProteinID: NP_001028311
MGI: 2147611
Ensembl: ENSMUSG00000024970
UniProt: Q05AH6
Position
19; 19 A
AA seq 381 aa AA seqDB search
MALKAKGAAALDCFEVTLKCEEGDDDDEAVVVAVIPRPEPMLRVTQQEKTPPPRPNLLEA
GVEGCEELKQQVSWEQEFLVGNSPGGSGRALCMVCGAEIRSPSADTARAHILEQHPHTLD
LSPSEKSNILEAWSEGVALLQDIQADQPSLPSLESGQDGQPDPISNPDPVRMPAEIVVLL
DSEDNPSLPKRLRPRGLRPLELPVTPVIEQGNKKPRGQRWKESPENEPARKKRSRHMTKI
LDPDPDPPSPESPTETFAAPAEVRHFTDGSFPPGFVLQLFSHTQLRTTDCKDSSKDSRAA
EGLPQPQNPSSASPPGLRGTLDLQVIRVRMEEPPAVSLLQDWSKHPQGTKGVGTGDKPDW
PTVLSESSATVKGQPKAGSGV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggccctgaaagccaagggcgccgcggctctggattgcttcgaggtgacgctcaagtgt
gaggaaggggatgatgacgacgaggccgtggtggtggccgtgatcccgcggcccgagccg
atgctccgagtaacccaacaggaaaagacgccgccacctcggcctaacctgctggaagca
ggtgttgaaggctgtgaggagctcaagcagcaagtgtcatgggagcaggagttcctggtg
gggaacagcccaggaggcagtggacgggcgctgtgcatggtgtgtggggctgagatccgg
tccccatcagcagacactgctcgcgcacacatcctggagcagcatcctcacaccctggac
ctgagcccctctgagaagagcaacatcttagaagcctggagtgaaggggttgcccttctg
caagacatccaagctgaccagccatccctgcccagcctagagtcaggccaggatggccag
ccagaccccatctccaacccggatcctgtcaggatgccagcagagatagtggtcctcttg
gattccgaggacaacccatcccttcctaagaggctccggcccagaggactccgccccctt
gagctgcccgttacccctgtcatagagcaagggaataaaaagccccgtggtcagagatgg
aaagagtcccctgagaatgaacctgctagaaagaagagaagcaggcatatgaccaaaatc
ttggaccctgacccagaccccccgtctcctgagtcacccacagagacattcgcagcacca
gctgaagtccgacacttcactgatggcagcttccctcctggcttcgtcctccagctcttc
tcccacactcagctcaggaccactgactgtaaggactcttctaaggacagcagagcagca
gagggcctgccccagccacaaaacccctcttcagcctcccctccggggctccgtgggaca
ctggatctccaggttatccgtgttcggatggaggaaccaccagccgtcagcctcttacag
gactggtccaagcacccccagggcaccaagggggtgggaacaggtgacaagccagactgg
cccacagttctgtcagaatccagtgccactgttaagggacaaccaaaggcagggagtgga
gtataa

DBGET integrated database retrieval system