KEGG   Mus musculus (mouse): 68235
Entry
68235             CDS       T01002                                 

Gene name
Mturn, 2410066E13Rik, AI448550, B230212L03Rik
Definition
(RefSeq) maturin, neural progenitor differentiation regulator homolog (Xenopus)
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: DUF4581
Other DBs
NCBI-GeneID: 68235
NCBI-ProteinID: NP_001276669
MGI: 1915485
Ensembl: ENSMUSG00000038065
Vega: OTTMUSG00000047435
UniProt: Q8CGA4
Position
6; 6 B3
AA seq 131 aa
MDFQQLADVAEKWCSSTPFELIAAEETERRMDFYADPGVSFYVLCPDNGCGDSFHVWSES
EDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPE
ADHPQMGVSQQ
NT seq 396 nt   +upstreamnt  +downstreamnt
atggacttccagcagctggcagatgtcgcggagaagtggtgttccagcacgccctttgag
ctcatcgccgccgaggagacggagcgcaggatggacttctacgccgacccgggcgtctcc
ttctacgtactgtgtccggacaacggctgcggcgacagctttcacgtgtggagcgagagc
gaggactgcctgcccttcttgcagctggcccaagattacatctcttcctgcggcaagaag
accctccatgaagtcttggaaaaagtcttcaaatccttcagacctttgctggggcttcca
gacgcagatgacgacgcgtttgaagagtacagtgcggatgtggaggaggaggagccagag
gcggaccacccgcaaatgggggtcagtcagcagtaa

DBGET integrated database retrieval system