KEGG   Mus musculus (house mouse): 68259
Entry
68259             CDS       T01002                                 
Symbol
Ift80, 4921524P20Rik, Wdr56, mKIAA1374
Name
(RefSeq) intraflagellar transport 80
  KO
K19678  intraflagellar transport protein 80
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    68259 (Ift80)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Intraflagellar transport (IFT) complex B2
   68259 (Ift80)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Coatomer_WDAD
Other DBs
NCBI-GeneID: 68259
NCBI-ProteinID: NP_080917
MGI: 1915509
Ensembl: ENSMUSG00000027778
UniProt: Q8K057
Position
3:complement(68799832..68911939)
AA seq 777 aa
MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPI
DLHWFPKSLGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTA
LVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAK
VLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPD
GELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVE
QRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFST
KNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQ
TVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGLTNDRKIA
FIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGIQDTRFTVWYYPNTIYV
DRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHISISPYPAILHEYVSSSK
WEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAIKDLPSRES
KMAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQ
KFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDRSSSGQSSKSVGLKH
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgagactgaagatatctctctcaaaggaaccaaagcatcaagaattagtgagctgtgtg
ggttggactacggcggaggagctgtactcatgcagtgacgaccaccagatcgtcaagtgg
aacctgctaaccagtgaaaccagcctaatagtcaagctgcctgatgacatctacccgata
gaccttcactggtttccaaagagtttaggcataaagaaacagacgcaggcagaaagcttc
gtcctcacaagctctgatggtaagtttcatctgatttccaagttaggaagagtggaaaag
agtgtagaagctcactgtggggctgtgctcgcaggacgatggaattatgaggggactgca
ttagtgacagttggagaagatggacaagtgaaaatctggtcaaagacagggatgctcaga
tcaactttagcccagcaaggaacaccagtgtactcagtagcctggggccctgattcagaa
aaggttctttatacagcaggcaaacagctcatcattaaacctcttcaaccaaatgctaaa
gttttacagtggaaagcccatgatggcatcattttaaaagtcgactggaactcagtgaat
gaccttattttatctgcgggtgaagactgtaagtataaggtttgggatagttatggccgc
gtgctgtacggctcccagcctcatgagcaccccatcacctcagtggcctgggctccagat
ggggagttatttgccgttggatcgtttcatacgttacgcttgtgtgataaaactgggtgg
tcatatgctttagagaaacccaacactggcagcatatttaacattgcgtggtctattgat
ggcactcagatcgcgggagcctgtgggaacgggcatgttgtctttgcacatgtggtggag
cagcgctgggagtggaaaaattttcaagtaacgctaacgaagagaaggaccatgcaggtt
cgcaacgttctcaatgatgccgtggatctcctggagttccgggacagagtcattaaagca
tccttaaaccacgcacacttggtggtctccacgtccctgcagtgctacgtgttctctacg
aagaactggaatacaccacttatatttgatctcaaagaaggaactgttagtttaattctg
caggcagaaagacattttcttctggtggatggcgggggtatctacctgcactcttatgaa
gggcgcttcatttcttctccaaagtttcctggcatgagaacagacatcctgaacgctcag
actgtgtctctgagcaatgacacgatagcaataaaggacaaagctgacgagaagataatc
ttcctctttgaggcgtcaactggaaaacccctaggggatgggaaacttctttctcataag
aatgaaatctcagaaattgctctggatcaaaaaggacttaccaatgacagaaaaattgct
ttcattgacaagaacagagatctctacatcacctctgtgaaacgatttgggaaagaagaa
cagattattaaacttggaaccatggtacatactttggcatggtgtgatacatgcaatatc
ctctgtggaattcaagatactcgattcacagtatggtattaccctaataccatttatgtg
gacagagacattctgcctaaaacattgtacgaaagagatgcaagtgaatatagtaaaaac
ccgcatatagtgagttttgttggaaatcaggtaactataagaagagctgatggctccctg
gtgcacatcagcatatcaccgtaccccgccatcctccatgagtatgtgagcagctccaag
tgggaagaggctgtaaggctttgccgctttgttaaggagcaaagcatgtgggcttgccta
gcggctatggctgttgctaatcgagatatggtcactgcagaaatagcctatgcagcagtt
ggggaaattgataaagttcggtacatcaatgctataaaagatcttccatctagagagtca
aaaatggcccacatactcatgtttagtgggaacatccaggaggctgaaacagtcctgctc
caggctggccttgtttatcaagccatacagatcaacattaatctctataactgggaaagg
gcgctggagttggctgtaaaatacaaaacccacgttgatacagtgctcgcttatcgtcag
aagttcttggacacatttggtaaacaggaaactaataaacgatatttacaatatgcagag
ggcctccaaatagactgggagaaaatcaaagccaaaattgagatggaaattactaaagaa
cgagaccgatcatccagcggccagtccagcaagagtgtgggcttaaagcactaa

DBGET integrated database retrieval system