KEGG   Mus musculus (mouse): 68262
Entry
68262             CDS       T01002                                 

Symbol
Agpat4, 1500003P24Rik
Name
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
  KO
K13523  lysophosphatidic acid acyltransferase / lysophosphatidylinositol acyltransferase [EC:2.3.1.51 2.3.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04072  Phospholipase D signaling pathway
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    68262 (Agpat4)
   00564 Glycerophospholipid metabolism
    68262 (Agpat4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    68262 (Agpat4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    68262 (Agpat4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     68262 (Agpat4)
    2.3.1.-  
     68262 (Agpat4)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   68262 (Agpat4)
SSDB
Motif
Pfam: Acyltransf_C Acyltransferase
Other DBs
NCBI-GeneID: 68262
NCBI-ProteinID: NP_080920
MGI: 1915512
Ensembl: ENSMUSG00000023827
Vega: OTTMUSG00000036581
UniProt: Q8K4X7
Position
17; 17 A1
AA seq 378 aa
MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQ
LVMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKV
LAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRF
TEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRNNENPTL
LGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPETPWV
PPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTE
IDKGSAYGNIDNKRKQTD
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggacctcatcgggctgctgaagtcccagtttctatgtcacctggtcttctgctacgtg
ttcatcgcctcggggctcattgtcaacgccatccagctgtgcacgctggtcatctggccc
atcaacaagcagctgttccgcaagatcaatgccagactctgctactgcgtctccagccag
ttggtgatgcttctggagtggtggtcgggcacggagtgtaccatctacaccgacccgaag
gcctgcccccactacgggaaggaaaacgccatcgtggtcctcaatcacaagtttgagatt
gactttctctgtggctggagcctggctgagcgcctggggatcctggggaactccaaagtc
ctggccaagaaagaactggcttatgtcccaatcattggctggatgtggtacttcgtggaa
atgatcttttgcacacgcaagtgggagcaagatcggcagacggttgccaagagcctgctg
cacctccgggactacccagagaagtatctgttcctgatccactgtgagggcacacggttc
acagagaagaaacaccaaatcagcatgcaggtggcccaagccaaggggctgcccagcctc
aaacaccacctgctgccgcgcaccaaaggctttgctattactgtgaagtgcttgcgagat
gttgtcccagctgtatatgactgtacactcaatttcagaaacaatgaaaacccaacactg
ctgggagtcttaaatggaaagaaatatcacgctgactgctacgttcggaggatccccatg
gaggacattccggaggatgaggacaagtgctctgcctggttacacaagctctaccaggag
aaggatgcctttcaggaggaatactacaggacaggggtcttcccagagactccctgggtt
cccccacggcggccctggtctctggtcaactggttgttctgggcatcgctgctgctctac
cctttcttccagttcctagttagcatggtcagcagcggttcctcggtgacgctggccagc
ttggtcctcatcttctgtatggcctccatgggagttcgatggatgattggcgtgacagaa
atcgacaagggctctgcctacggcaacatcgacaacaaacggaaacaaacggactga

DBGET integrated database retrieval system