KEGG   Mus musculus (mouse): 68263
Entry
68263             CDS       T01002                                 

Gene name
Pdhb, 2610103L06Rik, AL024199, C81408
Definition
(RefSeq) pyruvate dehydrogenase (lipoamide) beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00020  Citrate cycle (TCA cycle)
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04066  HIF-1 signaling pathway
mmu04922  Glucagon signaling pathway
mmu05230  Central carbon metabolism in cancer
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    68263 (Pdhb)
   00020 Citrate cycle (TCA cycle)
    68263 (Pdhb)
   00620 Pyruvate metabolism
    68263 (Pdhb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    68263 (Pdhb)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    68263 (Pdhb)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    68263 (Pdhb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68263 (Pdhb)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     68263 (Pdhb)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 68263
NCBI-ProteinID: NP_077183
MGI: 1915513
Ensembl: ENSMUSG00000021748
UniProt: Q9D051
Position
14; 14 A1
AA seq 359 aa
MAVVAGLVRGPLRQASGLLKRRFHRSAPAAVQLTVREAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSAGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVMLENELMYGVAFELPAEAQSKDFLIPIGKAKIERQGTHITVV
AHSRPVGHCLEAAAVLSKEGIECEVINLRTIRPMDIEAIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKVLEDNSVPQVKDIIFAVKKTLNI
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggtggtggctggtctggtgcggggacccttgcggcaggcttccgggctgctgaag
aggcgttttcaccgctcggcgcccgcagcggtgcagttgacagttcgtgaagctattaat
caaggtatggatgaagaactagaaagagatgaaaaagtttttctgcttggggaagaagtt
gcccagtatgacggtgcatacaaggttagcagaggcctgtggaagaaatacggtgacaag
aggatcatcgacacccccatctcagagatgggctttgctggaattgctgttggtgcagct
atggctgggttgcggcccatctgtgaatttatgaccttcaatttctctatgcaagctatt
gaccaggttataaactcagctgccaagacttactatatgtccgctggccttcagcctgtg
cccatagtattcagggggcccaatggcgcctcagcaggtgtagctgctcagcactcgcaa
tgctttgctgcatggtatgggcactgcccaggtttaaaagtggtcagcccctggaattcc
gaggatgcaaaaggacttattaaatcggccattcgtgataataacccagtggtaatgcta
gaaaatgaactgatgtatggagttgcatttgaacttcctgcagaagctcagtcaaaagat
ttcctgattcctattggaaaagccaaaattgaaaggcaagggacccacatcactgtagtt
gcccattcaagaccagtgggccactgcctagaagctgcagctgtattgtctaaggaggga
attgaatgtgaggtaataaatctgcgcaccatcagaccaatggacatcgaagccatagaa
gccagtgtgatgaagacaaatcatctcgtgactgtggaaggaggctggccacaatttgga
gtaggagctgagatttgtgccagaattatggaaggccctgcattcaacttccttgatgcc
cctgccgtgcgtgtcactggtgctgatgtccctatgccttacgcaaaggtcctagaagac
aactccgtacctcaggtcaaagacatcatatttgcagtaaagaagactctgaacatctga

DBGET integrated database retrieval system