KEGG   Mus musculus (mouse): 68267Help
Entry
68267             CDS       T01002                                 

Gene name
Slc25a22, 1300006L01Rik, AI060884, Gc1
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, glutamate), member 22
  KO
K15107  solute carrier family 25 (mitochondrial glutamate transporter), member 18/22
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    68267 (Slc25a22)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   68267 (Slc25a22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 68267
NCBI-ProteinID: NP_001171047
MGI: 1915517
Ensembl: ENSMUSG00000019082
Vega: OTTMUSG00000016510
UniProt: Q9D6M3 Q80X52
Position
7; 7 F5
AA seq 323 aa AA seqDB search
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRMYASMSDCLIKTIRSE
GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLPKEMLAGCGAGTCQVIV
TTPMEMLKIQLQDAGRIAAQRKILAAQAQLSAQGGAQPSVEAPAPPRPTATQLTRDLLRN
HGIAGLYKGLGATLLRDVPFSIVYFPLFANLNQLGRPSSEEKSPFYVSFLAGCVAGSAAA
VAVNPCDVVKTRLQSLERGVNEDTYSGFLDCARKIWRHEGPSAFLKGAYCRALVIAPLFG
IAQVVYFLGIAESLLGLLQEPQA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgataagcagatcagcctgccggccaagctcatcaatggtggcatcgctgggcta
atcggggtcacctgcgtgttccccatcgacctggctaagacacggctgcagaaccagcag
aatggccagcgcatgtatgccagcatgtctgattgcctcatcaagaccatccgctccgag
ggctacttcggcatgtataggggagcagcagtaaacctgaccctggtcaccccggagaag
gccatcaagttggcagctaatgacttcttcagacaccagctctctaaggatggacagaag
ctgaccttgcctaaggagatgctggcaggctgcggggccggcacctgccaggtgattgtg
accacccccatggagatgctgaagatccagttgcaagatgcaggccgcattgctgctcag
aggaagattctggctgcccaggctcagctctcagcccagggaggtgcccagccctcggta
gaggctccagcccctcctcggcccacggccacccagctgacccgtgacctgctgcggaat
catggcattgctggcctctacaagggactgggggccacgctactcagggatgttcccttc
tccattgtctacttccccctgtttgccaacctgaatcagctgggccgcccatcctctgag
gagaagtcgcctttctatgtgtccttcctagcaggctgcgtggctgggagtgcagccgct
gtggccgtcaacccttgtgatgtggtgaagactcggctccagtcccttgagagaggtgtt
aatgaggacacttactctgggtttctggactgtgcaaggaagatctggagacatgaaggt
ccctcagccttcctgaaaggcgcatactgccgtgcgctggtcattgccccgctgtttggc
atcgcccaggtggtctactttctgggcattgccgagtccctgctggggctgctgcaagaa
ccccaggcctga

DBGET integrated database retrieval system