KEGG   Mus musculus (mouse): 68268
Entry
68268             CDS       T01002                                 

Gene name
Zdhhc21, 9130404H11Rik, AL024349, D130004H04Rik, DHHC21, de, dep
Definition
(RefSeq) zinc finger, DHHC domain containing 21
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    68268 (Zdhhc21)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     68268 (Zdhhc21)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 68268
NCBI-ProteinID: NP_080923
MGI: 1915518
Ensembl: ENSMUSG00000028403
Vega: OTTMUSG00000000297
UniProt: Q9D270
Position
4 39.4 cM; 4 C3
AA seq 265 aa
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIIIFYGISIFC
LVALVRASLTDPGRLPENPKIPHAERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC
PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVVRHELAIM
RLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTR
WKILWFIPFRQRQPLRVPYHFANHV
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggtcttcggattcactttgttgttgacccgcatggttggtgctgcatgggcttgatt
gtctttgtctggttatacaatattgttataattcccaaaattgtcctctttcctcactat
gaagaaggacatattcctggcattttaataataatattctatggcatttccatattttgc
ctggttgccttagtgagggcctccttaactgatcctggaagactccctgaaaatcccaag
atcccacatgcagagcgggagctgtgggagctctgcaacaagtgcaacctgatgaggccg
aagcgctcccaccactgcagccgctgcggccactgcgtcaggaggatggaccatcactgt
ccttggataaacaattgtgtgggtgaagacaaccattggctctttctgcagttgtgtttc
tacactgagctgcttacttgctacgcactgatgttttctttctgccattattattatttt
cttccactaaaaaagcgtaacttggatctctttgttgttcgccatgagctggctatcatg
agactagctgccttcatgggcatcactatgttagttggaataactggactcttctataca
caactgattggcatcatcacagatacaacatctattgaaaaaatgtcaaattgttgtgaa
gaaatatcgcggccccgaaagccatggcagcagaccttctcagaagtttttggcactcgt
tggaagatcctgtggttcattcctttcaggcagcggcaaccactgcgagttccctaccac
tttgccaatcacgtctaa

DBGET integrated database retrieval system