KEGG   Mus musculus (mouse): 68295
Entry
68295             CDS       T01002                                 

Gene name
Aar2, 0610011L14Rik
Definition
(RefSeq) AAR2 splicing factor homolog
  KO
K13205  A1 cistron-splicing factor AAR2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    68295 (Aar2)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    68295 (Aar2)
SSDB
Motif
Pfam: AAR2
Other DBs
NCBI-GeneID: 68295
NCBI-ProteinID: NP_001158290
MGI: 1915545
Ensembl: ENSMUSG00000027628
Vega: OTTMUSG00000015877
UniProt: Q9D2V5 Q8C161
Position
2; 2 H1
AA seq 384 aa
MSSMQMDPELAKQLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLYY
SSVDKANPREVGPRMGFFLSLKQRGLTVLRWNAVQEEVDLSPAPEAEVEAMRANLPDLDQ
FLGPYPYATLKKWISLTNFISEATMEKLQPESRQICAFSDVLPVLFMKHTKDRVGQNLPL
CGTECRSYQEGLARLPEMRPRAGTEIRFSELPTQMFPAGATPAEITRHSMDLSYALETVL
SKQFPGNPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNLLCRSESAMGKYHALYISLIS
ILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVEATLRKKAEKFQAHLTKKFR
WDFTSEPEDCAPVVVELPEGIETA
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtcttccatgcagatggatccagagttagccaagcagctcttctttgaaggagccacg
gtggtcattctgaacatgcccaaggggacagagtttggcattgactacaactcttgggag
gtggggcccaagttccggggtgtgaagatgattccccctggcatccacttcctgtactac
agctctgtggacaaggccaatcccagggaggtgggccctcgcatgggcttcttcctcagc
ctgaagcagcgggggctgacagtcctgcgctggaatgcagtccaggaagaagtagacctg
tctccagctccagaggctgaagtagaagctatgagagccaatctcccagacctagaccag
tttctgggaccttacccatatgctacactcaagaaatggatctcactcaccaacttcatc
agtgaggccaccatggagaagctgcagcctgagagcaggcagatctgcgccttctcagat
gtgctgcctgtgcttttcatgaagcacaccaaggacagggtggggcagaacctgcccctc
tgcggcaccgagtgcagaagctaccaagagggcctagcccggctgcccgagatgaggccc
agggctgggacagagatccgcttctcagagttgcccactcagatgttcccagcaggagcc
acaccagcagagatcaccaggcacagcatggacttgagctatgccctcgaaactgtgctc
agcaagcagttccctggcaacccccaggatgtgcttggtgagctccagtttgcctttgtg
tgcttcttgctgggcaatgtgtatgaggcatttgagcactggaagcggctcctgaacctc
ctgtgtcggtctgaatctgccatggggaagtaccacgccctgtacatcagcctcatctcc
atcctgtaccaccagcttggtgagatccctgctgacttctttgtggacattgtctcccag
gacaacttcctcaccagtaccttacaggttttcttttcttctgcctgcagtattgctgtg
gaagccaccctgaggaagaaagctgagaagttccaagcccacctgactaagaagttccgc
tgggacttcacttcagagccagaggactgtgccccagtggtggtggagctccccgagggc
atcgagacggcctaa

DBGET integrated database retrieval system